1AD6: Retinoblastoma tumor suppressor

Domain A of human retinoblastoma tumor suppressor. Determined by X-ray diffraction at 2.3 Å resolution. Released 26 Aug 1998.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,567
Mol. weight: 21.34 kDa
Released: 26 Aug 1998

Explore 1AD6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1AD6 contains 10 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	384-390	7
α-helix	396-397	2
α-helix	398-405	8
α-helix	412-434	23
α-helix	439-468	30
α-helix	474-477	4
α-helix	480-497	18
α-helix	516-521	6
α-helix	525-538	14
α-helix	544-559	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Retinoblastoma tumor suppressor	A	protein	185	Homo sapiens	P06400 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1AD6_1 RETINOBLASTOMA TUMOR SUPPRESSOR (chains A)
VMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDIGYIFKEKFAKAVGQG
CVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMAT
YSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRI
MESLA

Primary citation

Structural similarity between the pocket region of retinoblastoma tumour suppressor and the cyclin-box. Kim, H.Y., Cho, Y. Nat Struct Biol (1997) 4:390-395. DOI 10.1038/nsb0597-390 · PubMed

Other PDB entries of the same protein (UniProt P06400 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2R7G 1.67 Å, Structure of the retinoblastoma protein pocket domain in complex with adenovirus E1A CR1…
1GUX 1.85 Å, Rb pocket bound to E7 lxcxe motif
4ELL 1.98 Å, Structure of the inactive retinoblastoma protein pocket domain
2QDJ 2.0 Å, Crystal structure of the Retinoblastoma protein N-domain provides insight into tumor…
9DHU 2.16 Å, The Retinoblastoma Protein with Mutation E533K
1N4M 2.2 Å, Structure of Rb tumor suppressor bound to the transactivation domain of E2F-2
9DHF 2.26 Å, The Retinoblastoma Protein with Mutation E554K
9DHC 2.32 Å, The Retinoblastoma Protein with Mutation S751Y
4CRI 2.35 Å, Crystal Structure of 53BP1 tandem tudor domains in complex with methylated K810 Rb peptide
9DGK 2.38 Å, The Retinoblastoma Protein with Mutation M704V
1H25 2.5 Å, CDK2/Cyclin A in complex with an 11-residue recruitment peptide from…
1PJM 2.5 Å, Mouse Importin alpha-bipartite NLS from human retinoblastoma protein Complex

Browse structure collections

About this viewer

MolViewer shows 1AD6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.