1AN2: Protein)

Recognition by max of its cognate DNA through a dimeric b/hlh/z domain. Determined by X-ray diffraction at 2.9 Å resolution. Released 17 Sept 1997.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: Mus musculus
Chains: 2
Atoms: 1,165
Mol. weight: 16.97 kDa
Released: 17 Sept 1997

Explore 1AN2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1AN2 contains 2 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	26-47	22
α-helix	62-102	41

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA (5'-d(gptpgptpapgpgptpcpapcpgptpgpapcpc ptpapcpapc)- 3')	B	DNA	22	Mus musculus
Protein (transcription factor max (tf max))	A	protein	86		P61244 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>1AN2_1 DNA (5'-D(*GP*TP*GP*TP*AP*GP*GP*TP*CP*AP*CP*GP*TP*GP*AP*CP*C P*TP*AP*CP*AP*C)- 3') (chains B)
GTGTAGGTCACGTGACCTACAC

Sequence of entity 2 (A), FASTA

>1AN2_2 PROTEIN (TRANSCRIPTION FACTOR MAX (TF MAX)) (chains A)
ADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYMRRKNHTH
QQDIDDLKRQNALLEQQVRALEKARS

Primary citation

Recognition by Max of its cognate DNA through a dimeric b/HLH/Z domain. Ferre-D'Amare, A.R., Prendergast, G.C., Ziff, E.B. et al. Nature (1993) 363:38-45. DOI 10.1038/363038a0 · PubMed

Other PDB entries of the same protein (UniProt P61244 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6G6K 1.35 Å, The crystal structures of Human MYC:MAX bHLHZip complex
1NKP 1.8 Å, Crystal structure of Myc-Max recognizing DNA
1NLW 2.0 Å, Crystal structure of Mad-Max recognizing DNA
6G6L 2.2 Å, The crystal structures of Human MYC:MAX bHLHZip complex
6G6J 2.25 Å, The crystal structures of Human MYC:MAX bHLHZip complex
5EYO 2.39 Å, The crystal structure of the Max bHLH domain in complex with 5-carboxyl cytosine DNA
7RCU 2.69 Å, Synthetic Max homodimer mimic in complex with DNA
1HLO 2.8 Å, The crystal structure of an intact human max-DNA complex: new insights into mechanisms…
8OTS 3.3 Å, OCT4 and MYC-MAX co-bound to a nucleosome
8OTT 3.3 Å, MYC-MAX bound to a nucleosome at SHL+5.8
1R05 Solution Structure of Max B-HLH-LZ

Browse structure collections

About this viewer

MolViewer shows 1AN2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.