1AVG: Thrombin inhibitor from triatoma pallidipennis

Thrombin inhibitor from triatoma pallidipennis. Determined by X-ray diffraction at 2.6 Å resolution. Released 30 Dec 1998.

Method: X-ray diffraction
Resolution: 2.6 Å
Organisms: Bos taurus, Triatoma pallidipennis
Chains: 3
Atoms: 3,730
Mol. weight: 50.6 kDa
Released: 30 Dec 1998

Explore 1AVG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1AVG contains 19 α-helices and 35 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 12 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	1
β-strand	20-21	2	2
α-helix	22-23	2
β-strand	30-35	6	3
β-strand	39-46	8	3
β-strand	51-54	4	3
α-helix	56-58	3
β-strand	60-60A	2	4
α-helix	60B-60D	3
β-strand	60F-60G	2	4
β-strand	64-68	5	3
β-strand	72	1	5
β-strand	81-83	3	3
β-strand	85-90	6	3
β-strand	95	1	6
β-strand	100	1	6
β-strand	104-108	5	3
α-helix	111-114	4
α-helix	120-121	2
β-strand	122	1	2
α-helix	123-124	2
α-helix	126-129C	7
β-strand	132	1	7
β-strand	134	1	7
β-strand	135-140	6	2
α-helix	149C-149E	3
β-strand	154	1	5
β-strand	156-162	7	2
α-helix	165-170	6
α-helix	175-176	2
β-strand	180-183	4	2
β-strand	189	1	1
β-strand	198-202	5	2
β-strand	207-215	9	2
β-strand	226-230	5	2
α-helix	232-234	3
α-helix	235-242	8

Chain I: 4 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	2	1	8
β-strand	4	1	8
α-helix	6-8	3
α-helix	17-20	4
β-strand	24-28	5	9
β-strand	37-43	7	9
β-strand	51-56	6	9
β-strand	66-71	6	9
β-strand	80-86	7	9
β-strand	92-101	10	9
β-strand	106-115	10	9
β-strand	122-128	7	9
α-helix	136-137	2
α-helix	138-141	4

Chain L: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	1C-1A	3
α-helix	8-10	3
α-helix	14C-14H	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Thrombin	L	protein	41	Bos taurus	P00735 (AlphaFold model)
Thrombin	H	protein	259	Bos taurus	P00735 (AlphaFold model)
Triabin	I	protein	142	Triatoma pallidipennis	Q27049 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>1AVG_1 THROMBIN (chains L)
FFNEKTFGAGEADCGLRPLFEKKQVQDQTEKELFESYIEGR

Sequence of entity 2 (H), FASTA

>1AVG_2 THROMBIN (chains H)
IVEGQDAEVGLSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTVDDLL
VRIGKHSRTRYERKVEKISMLDKIYIHPRYNWKENLDRDIALLKLKRPIELSDYIHPVCL
PDKQTAAKLLHAGFKGRVTGWGNRRETWTTSVAEVQPSVLQVVNLPLVERPVCKASTRIR
ITDNMFCAGYKPGEGKRGDACEGDSGGPFVMKSPYNNRWYQMGIVSWGEGCDRDGKYGFY
THVFRLKKWIQKVIDRLGS

Sequence of entity 3 (I), FASTA

>1AVG_3 TRIABIN (chains I)
AEGDDCSIEKAMGDFKPEEFFNGTWYLAHGPGVTSPAVCQKFTTSGSKGFTQIVEIGYNK
FESNVKFQCNQVDNKNGEQYSFKCKSSDNTEFEADFTFISVSYDNFALVCRSITFTSQPK
EDRYLVFERTKSDTDPDAKEIC

Primary citation

Structure of the thrombin complex with triabin, a lipocalin-like exosite-binding inhibitor derived from a triatomine bug. Fuentes-Prior, P., Noeske-Jungblut, C., Donner, P. et al. Proc Natl Acad Sci U S A (1997) 94:11845-11850. DOI 10.1073/pnas.94.22.11845 · PubMed

Other PDB entries of the same protein (UniProt P00735 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7A0D 1.6 Å, The Crystal Structure of Bovine Thrombin in complex with Hirudin (C16U/C28U) at 1.6…
1NL1 1.9 Å, Bovine prothrombin fragment 1 in complex with calcium ion
7A0E 1.9 Å, The Crystal Structure of Bovine Thrombin in complex with Hirudin (C6U/C14U) at 1.9…
1ETR 2.2 Å, Refined 2.3 Å X-ray crystal structure of bovine thrombin complexes formed with the…
1MKX 2.2 Å, The co-crystal structure of unliganded bovine alpha-thrombin and prethrombin-2: movement…
1UCY 2.2 Å, Thrombin complexed with fibrinopeptide a alpha (residues 7-19). Three complexes, one…
2PF2 2.2 Å, The CA+2 ion and membrane binding structure of the gla domain of ca-prothrombin fragment 1
3PMA 2.2 Å, 2.2 Angstrom crystal structure of the complex between Bovine Thrombin and Sucrose…
1BBR 2.3 Å, The structure of residues 7-16 of the a alpha chain of human fibrinogen bound to bovine…
1ETS 2.3 Å, Refined 2.3 Å X-ray crystal structure of bovine thrombin complexes formed with the…
1MKW 2.3 Å, The co-crystal structure of unliganded bovine alpha-thrombin and prethrombin-2: movement…
1NL2 2.3 Å, Bovine prothrombin fragment 1 in complex with calcium and lysophosphotidylserine

Browse structure collections

About this viewer

MolViewer shows 1AVG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.