1B34: Protein

Crystal structure of the D1D2 sub-complex from the human snrnp core domain. Determined by X-ray diffraction at 2.5 Å resolution. Released 13 Jan 2000.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,239
Mol. weight: 26.86 kDa
Released: 13 Jan 2000

Explore 1B34 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1B34 contains 5 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	3-8	6
β-strand	14-19	6	1
β-strand	24-32	9	1
β-strand	38-46	9	1
β-strand	53-60	8	1
α-helix	62-64	3
β-strand	65-69	5	1
α-helix	76-79	4

Chain B: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	28-38	11
β-strand	41-46	6	1
β-strand	51-59	9	1
β-strand	65-72	8	1
β-strand	94-101	8	1
α-helix	103-105	3
β-strand	106-111	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (small nuclear ribonucleoprotein sm D1)	A	protein	119	Homo sapiens	P62314 (AlphaFold model)
Protein (small nuclear ribonucleoprotein sm D2)	B	protein	118	Homo sapiens	P62316 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1B34_1 PROTEIN (SMALL NUCLEAR RIBONUCLEOPROTEIN SM D1) (chains A)
MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSI
RGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR

Sequence of entity 2 (B), FASTA

>1B34_2 PROTEIN (SMALL NUCLEAR RIBONUCLEOPROTEIN SM D2) (chains B)
MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFD
RHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK

Primary citation

Crystal structures of two Sm protein complexes and their implications for the assembly of the spliceosomal snRNPs. Kambach, C., Walke, S., Young, R. et al. Cell (1999) 96:375-387. DOI 10.1016/S0092-8674(00)80550-4 · PubMed

Other PDB entries of the same protein (UniProt P62314 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9S2E 2.4 Å, Human intron-lariat spliceosome-Aquarius (ILSaqr)
5XJL 2.5 Å, Crystal Structure of the Gemin2-binding domain of SMN, Gemin2 in Complex with…
7EVO 2.5 Å, The cryo-EM structure of the human 17S U2 snRNP
5XJU 2.58 Å, Crystal Structure of the Gemin2-binding domain of SMN, Gemin2dN39 in Complex with…
8H6L 2.6 Å, Cryo-EM structure of human exon-defined spliceosome in the early B state.
8H6K 2.7 Å, Cryo-EM structure of human exon-defined spliceosome in the mature B state.
8HK1 2.7 Å, The cryo-EM structure of human pre-17S U2 snRNP
8C6J 2.8 Å, Human spliceosomal PM5 C* complex
6ID1 2.86 Å, Cryo-EM structure of a human intron lariat spliceosome after Prp43 loaded (ILS2 complex)…
7DVQ 2.89 Å, Cryo-EM Structure of the Activated Human Minor Spliceosome (minor Bact Complex)
6ID0 2.9 Å, Cryo-EM structure of a human intron lariat spliceosome prior to Prp43 loaded (ILS1…
5XJT 2.92 Å, Crystal Structure of the Gemin2-binding domain of SMN, Gemin2 in Complex with…

Browse structure collections

About this viewer

MolViewer shows 1B34 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.