1B47: N-terminal domain of cbl

Structure of the N-terminal domain of cbl in complex with its binding site in zap-70. Determined by X-ray diffraction at 2.2 Å resolution. Released 27 Apr 1999.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 3
Atoms: 8,092
Mol. weight: 106.24 kDa
Ligands: CA
Released: 27 Apr 1999

Explore 1B47 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1B47 contains 60 α-helices and 21 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	48-51	4
α-helix	53-70	18
α-helix	73-75	3
α-helix	80	1
α-helix	84-101	18
α-helix	106-110	5
α-helix	113-136	24
α-helix	137-141	5
α-helix	146-168	23
α-helix	170-172	3
α-helix	176-178	3
α-helix	184-194	11
β-strand	199-201	3	1
α-helix	202-212	11
α-helix	218-228	11
β-strand	235-237	3	1
α-helix	238-248	11
α-helix	251-253	3
α-helix	254-258	5
α-helix	259-263	5
β-strand	268-271	4	2
α-helix	274-281	8
α-helix	282-284	3
β-strand	290-295	6	2
β-strand	303-308	6	2
β-strand	314-317	4	2
α-helix	324-333	10
β-strand	339-340	2	2

Chain B: 19 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	53-71	19
α-helix	73-75	3
α-helix	84-102	19
α-helix	103-105	3
α-helix	106-110	5
α-helix	113-136	24
α-helix	137-141	5
α-helix	146-168	23
α-helix	170-172	3
α-helix	176-178	3
α-helix	184-194	11
β-strand	199-201	3	3
α-helix	202-212	11
α-helix	218-228	11
β-strand	235-237	3	3
α-helix	238-247	10
α-helix	251-253	3
α-helix	254-258	5
α-helix	259-263	5
β-strand	268-271	4	4
α-helix	274-282	9
β-strand	290-296	7	4
β-strand	299-308	10	4
β-strand	314-317	4	4
α-helix	324-334	11
β-strand	339-340	2	4

Chain C: 20 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	48-51	4
α-helix	53-70	18
α-helix	80	1
α-helix	84-101	18
α-helix	106-110	5
α-helix	113-136	24
α-helix	137-141	5
α-helix	146-168	23
α-helix	170-172	3
α-helix	176-178	3
α-helix	184-194	11
β-strand	199-201	3	5
α-helix	202-212	11
α-helix	218-228	11
β-strand	235-237	3	5
α-helix	238-247	10
α-helix	251-253	3
α-helix	254-258	5
α-helix	259-263	5
β-strand	268-271	4	6
α-helix	274-281	8
α-helix	282-284	3
β-strand	290-295	6	6
β-strand	303-308	6	6
β-strand	314-317	4	6
α-helix	324-333	10
β-strand	339-340	2	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CBL	A, B, C	protein	304	Homo sapiens	P22681 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>1B47_1 CBL (chains A, B, C)
PPGTVDKKMVEKCWKLMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSRYEGKM
ETLGENEYFRVFMENLMKKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELK
GIFPSGLFQGDTFRITKADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKS
TIDLTCNDYISVFEFDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIH
KPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQN
PDLT

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	3

Primary citation

Structure of the amino-terminal domain of Cbl complexed to its binding site on ZAP-70 kinase. Meng, W., Sawasdikosol, S., Burakoff, S.J. et al. Nature (1999) 398:84-90. DOI 10.1038/18050 · PubMed

Other PDB entries of the same protein (UniProt P22681 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3BUX 1.35 Å, Crystal structure of c-Cbl-TKB domain complexed with its binding motif in c-Met
3BUW 1.45 Å, Crystal structure of c-Cbl-TKB domain complexed with its binding motif in Syk
7SIY 1.48 Å, cCBL TKB domain in complex with pZAP70 peptide
5HKY 1.8 Å, Crystal structure of c-Cbl TKBD domain in complex with SPRY2 peptide (36-60, pY55)…
5HKZ 1.8 Å, Crystal Structure of c-Cbl TKBD in complex with SPRY2 peptide (36-60, pY55) Refined to…
5HKX 1.85 Å, Crystal Structure of c-Cbl TKBD-RING domains (Y371E mutant) Refined to 1.85 A Resolution
3PLF 1.92 Å, Reverse Binding Mode of MetRD peptide complexed with c-Cbl TKB domain
2Y1N 2.0 Å, Structure of c-Cbl-ZAP-70 peptide complex
3BUM 2.0 Å, Crystal structure of c-Cbl-TKB domain complexed with its binding motif in Sprouty2
3BUN 2.0 Å, Crystal structure of c-Cbl-TKB domain complexed with its binding motif in Sprouty4
9ERZ 2.02 Å, Structure of CBL-TKBD bound to Ubiquitin-fused CBLock peptide
1YVH 2.05 Å, Crystal Structure of the c-Cbl TKB Domain in Complex with the APS pTyr-618 Phosphopeptide

Browse structure collections

About this viewer

MolViewer shows 1B47 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.