7SIY: CCBL TKB domain

cCBL TKB domain in complex with pZAP70 peptide. Determined by X-ray diffraction at 1.48 Å resolution. Released 9 Nov 2022.

Method: X-ray diffraction
Resolution: 1.48 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,912
Mol. weight: 36.07 kDa
Ligands: MG
Released: 9 Nov 2022

Explore 7SIY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7SIY contains 18 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	53-69	17
α-helix	73-75	3
α-helix	84-101	18
α-helix	106-111	6
α-helix	113-136	24
α-helix	137-141	5
α-helix	146-168	23
α-helix	176-178	3
α-helix	184-194	11
β-strand	199-201	3	1
α-helix	202-210	9
α-helix	218-228	11
β-strand	235-237	3	1
α-helix	238-247	10
α-helix	251-253	3
α-helix	254-258	5
α-helix	259-263	5
β-strand	268	1	2
α-helix	274-281	8
α-helix	282-284	3
β-strand	290-295	6	2
β-strand	303-308	6	2
β-strand	314-317	4	2
α-helix	324-333	10
β-strand	339-340	2	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase CBL	A	protein	304	Homo sapiens	P22681 (AlphaFold model)
Peptide from Tyrosine-protein kinase ZAP-70	Z	protein	7	Homo sapiens	P43403 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7SIY_1 E3 ubiquitin-protein ligase CBL (chains A)
PGTVDKKMVEKCWKLMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSRYEGKME
TLGENEYFRVFMENLMKKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKG
IFPSGLFQGDTFRITKADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKST
IDLTCNDYISVFEFDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHK
PGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNP
DLTG

Sequence of entity 2 (Z), FASTA

>7SIY_2 Peptide from Tyrosine-protein kinase ZAP-70 (chains Z)
XYTPEPX

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1

Primary citation

cCBL TKB domain in complex with pZAP70 peptide. Murray, J.M., Yu, C. To be published.

Other PDB entries of the same protein (UniProt P22681 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3BUX 1.35 Å, Crystal structure of c-Cbl-TKB domain complexed with its binding motif in c-Met
3BUW 1.45 Å, Crystal structure of c-Cbl-TKB domain complexed with its binding motif in Syk
5HKY 1.8 Å, Crystal structure of c-Cbl TKBD domain in complex with SPRY2 peptide (36-60, pY55)…
5HKZ 1.8 Å, Crystal Structure of c-Cbl TKBD in complex with SPRY2 peptide (36-60, pY55) Refined to…
5HKX 1.85 Å, Crystal Structure of c-Cbl TKBD-RING domains (Y371E mutant) Refined to 1.85 A Resolution
3PLF 1.92 Å, Reverse Binding Mode of MetRD peptide complexed with c-Cbl TKB domain
2Y1N 2.0 Å, Structure of c-Cbl-ZAP-70 peptide complex
3BUM 2.0 Å, Crystal structure of c-Cbl-TKB domain complexed with its binding motif in Sprouty2
3BUN 2.0 Å, Crystal structure of c-Cbl-TKB domain complexed with its binding motif in Sprouty4
9ERZ 2.02 Å, Structure of CBL-TKBD bound to Ubiquitin-fused CBLock peptide
1YVH 2.05 Å, Crystal Structure of the c-Cbl TKB Domain in Complex with the APS pTyr-618 Phosphopeptide
2CBL 2.1 Å, N-terminal domain of cbl in complex with its binding site on zap-70

Browse structure collections

About this viewer

MolViewer shows 7SIY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.