Structure of the N-terminal domain of cbl in complex with its binding site in zap-70. Determined by X-ray diffraction at 2.2 Å resolution. Released 27 Apr 1999.
Explore 1B47 in 3D Show helices and sheets RCSB PDB PDBe
1B47 contains 60 α-helices and 21 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 48-51 | 4 | |
| α-helix | 53-70 | 18 | |
| α-helix | 73-75 | 3 | |
| α-helix | 80 | 1 | |
| α-helix | 84-101 | 18 | |
| α-helix | 106-110 | 5 | |
| α-helix | 113-136 | 24 | |
| α-helix | 137-141 | 5 | |
| α-helix | 146-168 | 23 | |
| α-helix | 170-172 | 3 | |
| α-helix | 176-178 | 3 | |
| α-helix | 184-194 | 11 | |
| β-strand | 199-201 | 3 | 1 |
| α-helix | 202-212 | 11 | |
| α-helix | 218-228 | 11 | |
| β-strand | 235-237 | 3 | 1 |
| α-helix | 238-248 | 11 | |
| α-helix | 251-253 | 3 | |
| α-helix | 254-258 | 5 | |
| α-helix | 259-263 | 5 | |
| β-strand | 268-271 | 4 | 2 |
| α-helix | 274-281 | 8 | |
| α-helix | 282-284 | 3 | |
| β-strand | 290-295 | 6 | 2 |
| β-strand | 303-308 | 6 | 2 |
| β-strand | 314-317 | 4 | 2 |
| α-helix | 324-333 | 10 | |
| β-strand | 339-340 | 2 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 53-71 | 19 | |
| α-helix | 73-75 | 3 | |
| α-helix | 84-102 | 19 | |
| α-helix | 103-105 | 3 | |
| α-helix | 106-110 | 5 | |
| α-helix | 113-136 | 24 | |
| α-helix | 137-141 | 5 | |
| α-helix | 146-168 | 23 | |
| α-helix | 170-172 | 3 | |
| α-helix | 176-178 | 3 | |
| α-helix | 184-194 | 11 | |
| β-strand | 199-201 | 3 | 3 |
| α-helix | 202-212 | 11 | |
| α-helix | 218-228 | 11 | |
| β-strand | 235-237 | 3 | 3 |
| α-helix | 238-247 | 10 | |
| α-helix | 251-253 | 3 | |
| α-helix | 254-258 | 5 | |
| α-helix | 259-263 | 5 | |
| β-strand | 268-271 | 4 | 4 |
| α-helix | 274-282 | 9 | |
| β-strand | 290-296 | 7 | 4 |
| β-strand | 299-308 | 10 | 4 |
| β-strand | 314-317 | 4 | 4 |
| α-helix | 324-334 | 11 | |
| β-strand | 339-340 | 2 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 48-51 | 4 | |
| α-helix | 53-70 | 18 | |
| α-helix | 80 | 1 | |
| α-helix | 84-101 | 18 | |
| α-helix | 106-110 | 5 | |
| α-helix | 113-136 | 24 | |
| α-helix | 137-141 | 5 | |
| α-helix | 146-168 | 23 | |
| α-helix | 170-172 | 3 | |
| α-helix | 176-178 | 3 | |
| α-helix | 184-194 | 11 | |
| β-strand | 199-201 | 3 | 5 |
| α-helix | 202-212 | 11 | |
| α-helix | 218-228 | 11 | |
| β-strand | 235-237 | 3 | 5 |
| α-helix | 238-247 | 10 | |
| α-helix | 251-253 | 3 | |
| α-helix | 254-258 | 5 | |
| α-helix | 259-263 | 5 | |
| β-strand | 268-271 | 4 | 6 |
| α-helix | 274-281 | 8 | |
| α-helix | 282-284 | 3 | |
| β-strand | 290-295 | 6 | 6 |
| β-strand | 303-308 | 6 | 6 |
| β-strand | 314-317 | 4 | 6 |
| α-helix | 324-333 | 10 | |
| β-strand | 339-340 | 2 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| CBL | A, B, C | protein | 304 | Homo sapiens | P22681 (AlphaFold model) |
>1B47_1 CBL (chains A, B, C) PPGTVDKKMVEKCWKLMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSRYEGKM ETLGENEYFRVFMENLMKKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELK GIFPSGLFQGDTFRITKADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKS TIDLTCNDYISVFEFDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIH KPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQN PDLT
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 3 |
Structure of the amino-terminal domain of Cbl complexed to its binding site on ZAP-70 kinase. Meng, W., Sawasdikosol, S., Burakoff, S.J. et al. Nature (1999) 398:84-90. DOI 10.1038/18050 · PubMed
Other PDB entries of the same protein (UniProt P22681 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1B47 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.