1BA7: Soybean trypsin inhibitor

Soybean trypsin inhibitor. Determined by X-ray diffraction at 2.5 Å resolution. Released 17 Jun 1998.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Glycine max
Chains: 2
Atoms: 2,653
Mol. weight: 40.23 kDa
Released: 17 Jun 1998

Explore 1BA7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1BA7 contains 11 α-helices and 44 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	2	1	1
β-strand	4	1	2
α-helix	9	1
β-strand	10	1	2
α-helix	11	1
β-strand	12	1	3
β-strand	16-21	6	4
β-strand	29-32	4	5
β-strand	42-45	4	5
β-strand	56-59	4	4
β-strand	66	1	3
β-strand	68	1	1
β-strand	73-77	5	4
α-helix	84-86	3
β-strand	92	1	4
β-strand	94-96	3	5
β-strand	104-106	3	5
β-strand	113	1	5
α-helix	114-115	2
β-strand	116-122	7	4
β-strand	131-137	7	4
β-strand	146-147	2	4
β-strand	148-152	5	5
β-strand	159-163	5	5
β-strand	168	1	5
α-helix	169	1
β-strand	170-175	6	4

Chain B: 6 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	2	1	6
β-strand	4	1	7
β-strand	5	1	8
β-strand	10	1	7
α-helix	11	1
β-strand	12	1	9
β-strand	16-21	6	8
β-strand	28-32	5	8
β-strand	42-45	4	8
β-strand	56-59	4	8
β-strand	66	1	9
β-strand	68	1	6
β-strand	73-77	5	8
α-helix	84-86	3
β-strand	92	1	8
β-strand	94-96	3	8
β-strand	104-106	3	8
β-strand	113	1	8
α-helix	114-115	2
β-strand	116-122	7	8
β-strand	131-137	7	8
α-helix	145	1
β-strand	146-152	7	8
β-strand	159-164	6	8
α-helix	167	1
β-strand	168	1	8
α-helix	169	1
β-strand	170-175	6	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Trypsin inhibitor (KUNITZ)	A, B	protein	181	Glycine max	P01070 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1BA7_1 TRYPSIN INHIBITOR (KUNITZ) (chains A, B)
DFVLDNEGNPLENGGTYYILSDITAFGGIRAAPTGNERCPLTVVQSRNELDKGIGTIISS
PYRIRFIAEGHPLSLKFDSFAVIMLCVGIPTEWSVVEDLPEGPAVKIGENKDAMDGWFRL
ERVSDDEFNNYKLVFCPQQAEDDKCGDIGISIDHDDGTRRLVVSKNKPLVVQFQKLDKES
L

Primary citation

Structure of the Kunitz-type soybean trypsin inhibitor (STI): implication for the interactions between members of the STI family and tissue-plasminogen activator. De Meester, P., Brick, P., Lloyd, L.F. et al. Acta Crystallogr D Biol Crystallogr (1998) 54:589-597. DOI 10.1107/S0907444997015849 · PubMed

Other PDB entries of the same protein (UniProt P01070 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1AVW 1.75 Å, Complex porcine pancreatic trypsin/soybean trypsin inhibitor, orthorhombic crystal form
1AVX 1.9 Å, Complex porcine pancreatic trypsin/soybean trypsin inhibitor, tetragonal crystal form
6O1F 2.15 Å, Complex between soybean trypsin inhibitor beta1-tryptase and a humanized fab
1AVU 2.3 Å, Trypsin inhibitor from soybean (STI)
6NTT 2.4 Å, X-ray Crystal Structure of Soybean Trypsin Inhibitor (Kunitz) Complexed with…

Browse structure collections

About this viewer

MolViewer shows 1BA7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.