1BBN: Interleukin-4

Three-dimensional solution structure of human interleukin-4 by multi-dimensional heteronuclear magnetic resonance spectroscopy. Determined by solution NMR. Released 31 Oct 1993.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,076
Mol. weight: 15.39 kDa
Released: 31 Oct 1993

Explore 1BBN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1BBN contains 6 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	10-20	11
β-strand	33-34	2	1
α-helix	45-61	17
α-helix	63-65	3
α-helix	67-70	4
α-helix	75-98	24
β-strand	110-111	2	1
α-helix	113-128	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-4	A	protein	133	Homo sapiens	P05112 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1BBN_1 INTERLEUKIN-4 (chains A)
EAEAHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKDTTEKETFCRAATVLRQFY
SHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEADQSTLENFLERL
KTIMREKYSKCSS

Primary citation

Three-dimensional solution structure of human interleukin-4 by multidimensional heteronuclear magnetic resonance spectroscopy. Powers, R., Garrett, D.S., March, C.J. et al. Science (1992) 256:1673-1677. PubMed

Other PDB entries of the same protein (UniProt P05112 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2D48 1.65 Å, Crystal structure of the Interleukin-4 variant T13D
2B8X 1.7 Å, Crystal structure of the interleukin-4 variant F82D
2B8U 1.8 Å, Crystal structure of wildtype human Interleukin-4
2B8Y 1.8 Å, Crystal structure of the interleukin-4 variant T13DF82D
2B91 2.0 Å, Crystal structure of the interleukin-4 variant F82DR85A
4YDY 2.0 Å, Crystal structure of darpin 44C12V5 in complex with human il-4
1HZI 2.05 Å, Interleukin-4 mutant E9A
2B90 2.1 Å, Crystal structure of the interleukin-4 variant T13DR85A
1RCB 2.25 Å, Crystal structure of human recombinant interleukin-4 at 2.25 Å resolution
1IAR 2.3 Å, Interleukin-4 / receptor alpha chain complex
2INT 2.35 Å, Crystal structure of recombinant human interleukin-4
2B8Z 2.5 Å, Crystal structure of the interleukin-4 variant R85A

Browse structure collections

About this viewer

MolViewer shows 1BBN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.