1BBZ: Abl-SH3 domain

Crystal structure of the abl-SH3 domain complexed with a designed high-affinity peptide ligand: implications for SH3-ligand interactions. Determined by X-ray diffraction at 1.65 Å resolution. Released 25 Nov 1998.

Method: X-ray diffraction
Resolution: 1.65 Å
Organism: Homo sapiens
Chains: 8
Atoms: 2,415
Mol. weight: 30.22 kDa
Released: 25 Nov 1998

Explore 1BBZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1BBZ contains 8 α-helices and 32 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, C and E: 1 helix, 8 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	1
β-strand	9	1	2
β-strand	16	1	1
β-strand	19	1	2
β-strand	24-30	7	1
β-strand	36-41	6	1
β-strand	44-49	6	1
α-helix	50-52	3
β-strand	53-55	3	1

Chains B, D, F and H: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	5-9	5

Chain G: 1 helix, 8 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	7
β-strand	9	1	8
β-strand	16	1	7
β-strand	19	1	8
β-strand	24-30	7	7
β-strand	36-40	5	7
β-strand	45-49	5	7
α-helix	50-52	3
β-strand	53-55	3	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Abl tyrosine kinase	A, C, E, G	protein	58	Homo sapiens	P00519 (AlphaFold model)
Peptide P41	B, D, F, H	protein	11

Sequence of entity 1 (A, C, E, G), FASTA

>1BBZ_1 ABL TYROSINE KINASE (chains A, C, E, G)
NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNS

Sequence of entity 2 (B, D, F, H), FASTA

>1BBZ_2 PEPTIDE P41 (chains B, D, F, H)
XAPSYSPPPPP

Primary citation

Crystal structure of the abl-SH3 domain complexed with a designed high-affinity peptide ligand: implications for SH3-ligand interactions. Pisabarro, M.T., Serrano, L., Wilmanns, M. J Mol Biol (1998) 281:513-521. DOI 10.1006/jmbi.1998.1932 · PubMed

Other PDB entries of the same protein (UniProt P00519 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5OAZ 1.03 Å, Crystal structure of the Abl-SH3 domain at pH 7.5
7PVS 1.05 Å, Crystal structure of the Abl SH3 domain V73E-A74S-S75R-G76T-D77E-G92N-Y93N-N94T-H95E…
4J9C 1.05 Å, Crystal structure of the Abl-SH3 domain H59Q-N96T mutant complexed with the designed…
4J9F 1.09 Å, Crystal structure of the Abl-SH3 domain complexed with the high affinity peptide P0
7PW2 1.1 Å, Crystal structure of the Abl SH3 domain V73E-A74S-S75R-G76T-D77E mutant
3EG3 1.4 Å, Crystal structure of the N114A mutant of ABL-SH3 domain
4J9E 1.4 Å, Crystal structure of the N114A mutant of the Abl-SH3 domain complexed with the high…
5DC4 1.48 Å, Crystal structure of monobody AS25/ABL1 SH2 domain complex, crystal a
4J9D 1.5 Å, Crystal structure of the N114A mutant of the Abl-SH3 domain complexed with the high…
5HU9 1.53 Å, Crystal structure of ABL1 in complex with CHMFL-074
7PVQ 1.55 Å, Crystal structure of the Abl SH3 domain V73E-A74S-S75R-G76T-D77E-G92N-Y93N-N94T-H95E…
5DC9 1.56 Å, Crystal structure of monobody AS25/ABL1 SH2 domain complex, crystal B

Browse structure collections

About this viewer

MolViewer shows 1BBZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.