1BQS: Mucosal addressin cell adhesion molecule-1

The crystal structure of mucosal addressin cell adhesion molecule-1 (madcam-1). Determined by X-ray diffraction at 2.2 Å resolution. Released 13 Aug 1999.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,645
Mol. weight: 22.34 kDa
Ligands: NAG
Released: 13 Aug 1999

Explore 1BQS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1BQS contains 2 α-helices and 20 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	12-16	5	2
β-strand	21-27	7	1
β-strand	35-39	5	2
β-strand	46-50	5	1
β-strand	55-59	5	1
α-helix	64-66	3
β-strand	68-76	9	2
β-strand	79-90	12	2
β-strand	91	1	3
β-strand	96-99	4	4
β-strand	103	1	5
β-strand	109-117	9	4
β-strand	118	1	3
β-strand	126-131	6	6
β-strand	134-135	2	6
α-helix	136	1
β-strand	147-150	4	4
β-strand	158-168	11	4
β-strand	179-188	10	6
β-strand	191-200	10	6
β-strand	201	1	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (mucosal addressin cell adhesion molecule-1)	A	protein	209	Homo sapiens	Q13477 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1BQS_1 PROTEIN (MUCOSAL ADDRESSIN CELL ADHESION MOLECULE-1) (chains A)
VKPLQVEPPEPVVAVALGASRQLTCRLACADRGASVQWRGLDTSLGAVQSDTGRSVLTVR
NASLSAAGTRVCVGSCGGRTFQHTVQLLVYAFPNQLTVSPAALVPGDPEVACTAHKVTPV
DPNALSFSLLVGGQELEGAQALGPEVQEEEEEPQGDEDVLFRVTERWRLPPLGTPVPPAL
YCQATMRLPGLELSHRQAIPVLHSPTSPE

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1

Primary citation

The structure of immunoglobulin superfamily domains 1 and 2 of MAdCAM-1 reveals novel features important for integrin recognition. Tan, K., Casasnovas, J.M., Liu, J.H. et al. Structure (1998) 6:793-801. DOI 10.1016/S0969-2126(98)00080-X · PubMed

Other PDB entries of the same protein (UniProt Q13477 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4HBQ 1.4 Å, Crystal structure of a loop deleted mutant of Human MAdCAM-1 D1D2
4HD9 1.7 Å, Crystal structure of native human MAdCAM-1 D1D2 domain
1GSM 1.9 Å, A reassessment of the MAdCAM-1 structure and its role in integrin recognition.
4HCR 2.3 Å, Crystal structure of human MAdCAM-1 D1D2 complexed with Fab PF-547659
4HC1 2.87 Å, Crystal structure of a loop deleted mutant of human MAdCAM-1 D1D2 complexed with Fab 10G3
9P95 3.05 Å, CryoEM structure of integrin alpha4beta7 bound to MAdCAM-1

Browse structure collections

About this viewer

MolViewer shows 1BQS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.