1GSM: Mucosal addressin cell adhesion molecule-1

A reassessment of the MAdCAM-1 structure and its role in integrin recognition. Determined by X-ray diffraction at 1.9 Å resolution. Released 29 Jan 2002.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 1,715
Mol. weight: 22.29 kDa
Released: 29 Jan 2002

Explore 1GSM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1GSM contains 4 α-helices and 23 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	12-16	5	2
β-strand	21-27	7	1
β-strand	35-39	5	2
β-strand	48-51	4	2
β-strand	54-59	6	1
α-helix	64-66	3
β-strand	68-76	9	2
β-strand	79-90	12	2
β-strand	91	1	3
β-strand	95-99	5	4
β-strand	103	1	5
β-strand	105	1	6
β-strand	107	1	6
β-strand	109-117	9	4
β-strand	118	1	3
β-strand	125-131	7	7
β-strand	134-135	2	7
α-helix	136	1
β-strand	140-141	2	4
β-strand	145-148	4	4
β-strand	161-168	8	4
α-helix	169-171	3
α-helix	176-177	2
β-strand	179-188	10	7
β-strand	191-200	10	7
β-strand	201	1	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mucosal addressin cell adhesion molecule-1	A	protein	210	HOMO SAPIENS	Q13477 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1GSM_1 MUCOSAL ADDRESSIN CELL ADHESION MOLECULE-1 (chains A)
QSLQVKPLQVEPPEPVVAVALGASRQLTCRLACADRGASVQWRGLDTSLGAVQSDTGRSV
LTVRNASLSAAGTRVCVGSCGGRTFQHTVQLLVYAFPNQLTVSPAALVPGDPEVACTAHK
VTPVDPNALSFSLLVGGQELEGAQALGPEVQEEEEEPQGDEDVLFRVTERWRLPPLGTPV
PPALYCQATMRLPGLELSHRQAIPVLIEGR

Primary citation

A Reassessment of the Madcam-1 Structure and its Role in Integrin Recognition. Dando, J., Wilkinson, K.W., Ortlepp, S. et al. Acta Crystallogr D Biol Crystallogr (2002) 58:233. DOI 10.1107/S0907444901020522 · PubMed

Other PDB entries of the same protein (UniProt Q13477 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4HBQ 1.4 Å, Crystal structure of a loop deleted mutant of Human MAdCAM-1 D1D2
4HD9 1.7 Å, Crystal structure of native human MAdCAM-1 D1D2 domain
1BQS 2.2 Å, The crystal structure of mucosal addressin cell adhesion molecule-1 (madcam-1)
4HCR 2.3 Å, Crystal structure of human MAdCAM-1 D1D2 complexed with Fab PF-547659
4HC1 2.87 Å, Crystal structure of a loop deleted mutant of human MAdCAM-1 D1D2 complexed with Fab 10G3
9P95 3.05 Å, CryoEM structure of integrin alpha4beta7 bound to MAdCAM-1

Browse structure collections

About this viewer

MolViewer shows 1GSM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.