The crystal structure of mucosal addressin cell adhesion molecule-1 (madcam-1). Determined by X-ray diffraction at 2.2 Å resolution. Released 13 Aug 1999.
Explore 1BQS in 3D Show helices and sheets RCSB PDB PDBe
1BQS contains 2 α-helices and 20 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-7 | 4 | 1 |
| β-strand | 12-16 | 5 | 2 |
| β-strand | 21-27 | 7 | 1 |
| β-strand | 35-39 | 5 | 2 |
| β-strand | 46-50 | 5 | 1 |
| β-strand | 55-59 | 5 | 1 |
| α-helix | 64-66 | 3 | |
| β-strand | 68-76 | 9 | 2 |
| β-strand | 79-90 | 12 | 2 |
| β-strand | 91 | 1 | 3 |
| β-strand | 96-99 | 4 | 4 |
| β-strand | 103 | 1 | 5 |
| β-strand | 109-117 | 9 | 4 |
| β-strand | 118 | 1 | 3 |
| β-strand | 126-131 | 6 | 6 |
| β-strand | 134-135 | 2 | 6 |
| α-helix | 136 | 1 | |
| β-strand | 147-150 | 4 | 4 |
| β-strand | 158-168 | 11 | 4 |
| β-strand | 179-188 | 10 | 6 |
| β-strand | 191-200 | 10 | 6 |
| β-strand | 201 | 1 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein (mucosal addressin cell adhesion molecule-1) | A | protein | 209 | Homo sapiens | Q13477 (AlphaFold model) |
>1BQS_1 PROTEIN (MUCOSAL ADDRESSIN CELL ADHESION MOLECULE-1) (chains A) VKPLQVEPPEPVVAVALGASRQLTCRLACADRGASVQWRGLDTSLGAVQSDTGRSVLTVR NASLSAAGTRVCVGSCGGRTFQHTVQLLVYAFPNQLTVSPAALVPGDPEVACTAHKVTPV DPNALSFSLLVGGQELEGAQALGPEVQEEEEEPQGDEDVLFRVTERWRLPPLGTPVPPAL YCQATMRLPGLELSHRQAIPVLHSPTSPE
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 1 |
The structure of immunoglobulin superfamily domains 1 and 2 of MAdCAM-1 reveals novel features important for integrin recognition. Tan, K., Casasnovas, J.M., Liu, J.H. et al. Structure (1998) 6:793-801. DOI 10.1016/S0969-2126(98)00080-X · PubMed
Other PDB entries of the same protein (UniProt Q13477 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1BQS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.