1C1G: Tropomyosin

Crystal structure of tropomyosin at 7 Å resolution in the spermine-induced crystal form. Determined by X-ray diffraction at 7.0 Å resolution. Released 11 Feb 2000.

Method: X-ray diffraction
Resolution: 7.0 Å
Organism: Sus scrofa
Chains: 4
Atoms: 9,160
Mol. weight: 131.14 kDa
Released: 11 Feb 2000

Explore 1C1G in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1C1G contains 13 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	2-165	164
α-helix	167-283	117

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	286-448	163
α-helix	450-565	116

Chain C: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	570-677	108
α-helix	679-702	24
α-helix	703-707	5
α-helix	708-849	142

Chain D: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	854-960	107
α-helix	962-988	27
α-helix	990-1016	27
α-helix	1018-1086	69
α-helix	1088-1133	46

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tropomyosin	A, B, C, D	protein	284	Sus scrofa	P42639 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>1C1G_1 TROPOMYOSIN (chains A, B, C, D)
MDAIKKKMQMLKLDKENALDRADEAEADKKAAEDRSKQLEDELVSLQKKLKATEDELDKY
SEALKDAQEKLELAEKKATDAEADVASLNRRIQLFEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAE
ERAELSEGKCAELEEEIKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAE
FAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI

Primary citation

Crystal structure of tropomyosin at 7 Angstroms resolution. Whitby, F.G., Phillips Jr., G.N. Proteins (2000) 38:49-59. DOI 10.1002/(SICI)1097-0134(20000101)38:1<49::AID-PROT6>3.3.CO;2-2 · PubMed

Other PDB entries of the same protein (UniProt P42639 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8DD0 3.5 Å, The structure of the native cardiac thin filament junction region
9YA8 4.32 Å, The structure of the cardiac native crossbridge in the rigor state, myosin heads bound…
9YK9 4.5 Å, The structure of the cardiac native crossbridge in the rigor state, myosin heads bound…
9YAQ 4.63 Å, The structure of the cardiac native cross bridge in the rigor state, myosin heads bound…
9YJP 4.8 Å, The structure of the cardiac native crossbridge in the rigor state, myosin heads bound…
8UWW 5.1 Å, The structure of the native cardiac thin filament troponin core in Ca2+-free state from…
8V0K 5.2 Å, The structure of the native cardiac thin filament troponin core in Ca2+-bound partially…
8UYD 5.3 Å, The structure of the native cardiac thin filament troponin core in Ca2+-free state from…
8UZY 5.3 Å, The structure of the native cardiac thin filament troponin core in Ca2+-bound partially…
9YKN 5.3 Å, The structure of the cardiac native crossbridge in the rigor state, myosin heads with…
8UZX 5.4 Å, The structure of the native cardiac thin filament troponin core in Ca2+-bound fully…
8UWY 5.5 Å, The structure of the native cardiac thin filament troponin core in Ca2+-free rotated…

Browse more

1C1G is part of these collections:

Motor proteins and the cytoskeleton

About this viewer

MolViewer shows 1C1G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.