X-ray structure of human stromelysin catalytic domain complexes with non-peptide inhibitors: implication for inhibitor selectivity. Determined by X-ray diffraction at 1.8 Å resolution. Released 7 Jul 1999.
Explore 1CAQ in 3D Show helices and sheets RCSB PDB PDBe
1CAQ contains 4 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 85 | 1 | 1 |
| β-strand | 96-101 | 6 | 2 |
| α-helix | 110-125 | 16 | |
| β-strand | 131-134 | 4 | 2 |
| β-strand | 142-147 | 6 | 2 |
| β-strand | 165-167 | 3 | 2 |
| β-strand | 178-181 | 4 | 2 |
| β-strand | 186-187 | 2 | 3 |
| β-strand | 193-194 | 2 | 3 |
| α-helix | 195-206 | 12 | |
| β-strand | 209 | 1 | 1 |
| α-helix | 229-231 | 3 | |
| α-helix | 236-246 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein (stromelysin-1) | A | protein | 168 | Homo sapiens | P08254 (AlphaFold model) |
>1CAQ_1 PROTEIN (STROMELYSIN-1) (chains A) FRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADI MISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHE IGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPP
| ID | Name | Formula | Copies |
|---|---|---|---|
| DPS | 3-(1H-indol-3-yl)-2-[4-(4-phenyl-piperidin-1-yl)-benzenesulfonylamino]-propioni… | C28 H29 N3 O4 S | 1 |
| CA | Calcium ion | Ca | 3 |
| ZN | Zinc ion | Zn | 2 |
Water and common crystallization additives (SO4) are not listed.
X-ray structure of human stromelysin catalytic domain complexed with nonpeptide inhibitors: implications for inhibitor selectivity. Pavlovsky, A.G., Williams, M.G., Ye, Q.Z. et al. Protein Sci (1999) 8:1455-1462. PubMed
Other PDB entries of the same protein (UniProt P08254 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1CAQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.