Structure of MMP3 complexed with a platinum-based inhibitor. Determined by X-ray diffraction at 1.96 Å resolution. Released 27 Feb 2013.
Explore 4JA1 in 3D Show helices and sheets RCSB PDB PDBe
4JA1 contains 7 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 85 | 1 | 1 |
| β-strand | 96-101 | 6 | 2 |
| β-strand | 104 | 1 | 3 |
| α-helix | 110-125 | 16 | |
| β-strand | 131-134 | 4 | 2 |
| β-strand | 142-147 | 6 | 2 |
| β-strand | 165-167 | 3 | 2 |
| β-strand | 178-181 | 4 | 2 |
| β-strand | 186-187 | 2 | 4 |
| β-strand | 193-194 | 2 | 4 |
| α-helix | 195-206 | 12 | |
| β-strand | 209 | 1 | 1 |
| α-helix | 229-231 | 3 | |
| α-helix | 236-246 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 96-101 | 6 | 5 |
| β-strand | 104 | 1 | 3 |
| α-helix | 110-125 | 16 | |
| β-strand | 131-134 | 4 | 5 |
| β-strand | 142-147 | 6 | 5 |
| β-strand | 165-167 | 3 | 5 |
| β-strand | 178-181 | 4 | 5 |
| β-strand | 186-187 | 2 | 6 |
| β-strand | 193-194 | 2 | 6 |
| α-helix | 195-206 | 12 | |
| α-helix | 236-246 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Stromelysin-1 | A, B | protein | 173 | Homo sapiens | P08254 (AlphaFold model) |
>4JA1_1 Stromelysin-1 (chains A, B) FRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADI MISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHE IGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPET
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 4 |
| CA | Calcium ion | Ca | 6 |
| PT | Platinum (II) ion | Pt | 3 |
| NGH | N-isobutyl-N-[4-methoxyphenylsulfonyl]glycyl hydroxamic acid | C13 H20 N2 O5 S | 1 |
Water and common crystallization additives (CL) are not listed.
Structure of matrix metalloproteinase-3 with a platinum-based inhibitor. Belviso, B.D., Caliandro, R., Siliqi, D. et al. Chem Commun (Camb) (2013) 49:5492-5494. DOI 10.1039/c3cc41278d · PubMed
Other PDB entries of the same protein (UniProt P08254 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4JA1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.