1CQR: Stromelysin catalytic domain

Crystal structure of the stromelysin catalytic domain at 2.0 a resolution. Determined by X-ray diffraction at 2.0 Å resolution. Released 20 Mar 2000.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,814
Mol. weight: 39.34 kDa
Ligands: ZN, CA
Released: 20 Mar 2000

Explore 1CQR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1CQR contains 9 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	84-85	2	1
β-strand	96-101	6	2
β-strand	104	1	3
α-helix	110-125	16
β-strand	131-134	4	2
β-strand	142-147	6	2
β-strand	165-167	3	2
α-helix	168-169	2
β-strand	178-181	4	2
β-strand	186-187	2	4
β-strand	193-194	2	4
α-helix	195-207	13
β-strand	209-210	2	1
α-helix	236-246	11
α-helix	250	1

Chain B: 4 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	84-85	2	5
β-strand	96-101	6	6
β-strand	104	1	3
α-helix	110-125	16
β-strand	131-134	4	6
β-strand	142-147	6	6
β-strand	165-167	3	6
β-strand	178-181	4	6
β-strand	186-187	2	7
β-strand	193-194	2	7
α-helix	195-207	13
β-strand	209-210	2	5
α-helix	228-231	4
α-helix	236-245	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Stromelysin-1	A, B	protein	173	Homo sapiens	P08254 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1CQR_1 STROMELYSIN-1 (chains A, B)
FRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADI
MISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHE
IGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPET

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	4
CA	Calcium ion	Ca	6

Primary citation

Crystal structure of the stromelysin catalytic domain at 2.0 A resolution: inhibitor-induced conformational changes. Chen, L., Rydel, T.J., Gu, F. et al. J Mol Biol (1999) 293:545-557. DOI 10.1006/jmbi.1999.3147 · PubMed

Other PDB entries of the same protein (UniProt P08254 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1HY7 1.5 Å, A carboxylic acid based inhibitor in complex with MMP3
1CIZ 1.64 Å, X-ray structure of human stromelysin catalytic domain complexes with non-peptide…
1HFS 1.7 Å, Crystal structure of the catalytic domain of human fibroblast stromelysin-1 inhibited…
1CAQ 1.8 Å, X-ray structure of human stromelysin catalytic domain complexes with non-peptide…
1USN 1.8 Å, Crystal structure of the catalytic domain of human fibroblast stromelysin-1 inhibited…
1C3I 1.83 Å, Human stromelysin-1 catalytic domain complexed with ro-26-2812
4G9L 1.88 Å, Structure of MMP3 complexed with NNGH inhibitor.
1G49 1.9 Å, A carboxylic acid based inhibitor in complex with MMP3
1SLM 1.9 Å, Crystal structure of fibroblast stromelysin-1: the C-truncated human proenzyme
4DPE 1.96 Å, Structure of MMP3 complexed with a platinum-based inhibitor.
4JA1 1.96 Å, Structure of MMP3 complexed with a platinum-based inhibitor
1B8Y 2.0 Å, X-ray structure of human stromelysin catalytic domain complexed with non-peptide…

Browse structure collections

About this viewer

MolViewer shows 1CQR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.