1HFS: Stromelysin-1

Crystal structure of the catalytic domain of human fibroblast stromelysin-1 inhibited with the N-carboxy-alkyl inhibitor L-764,004. Determined by X-ray diffraction at 1.7 Å resolution. Released 18 Feb 1998.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,471
Mol. weight: 18.9 kDa
Ligands: ZN, CA, L04
Released: 18 Feb 1998

Explore 1HFS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1HFS contains 5 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	96-101	6	1
α-helix	110-125	16
β-strand	131-134	4	1
β-strand	142-147	6	1
β-strand	165-167	3	1
α-helix	168-169	2
β-strand	178-181	4	1
β-strand	186-187	2	2
β-strand	193-194	2	2
α-helix	195-206	12
α-helix	229-231	3
α-helix	236-245	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Stromelysin-1	A	protein	160	Homo sapiens	P08254 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1HFS_1 STROMELYSIN-1 (chains A)
GIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFA
VREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSL
GLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYG

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2
CA	Calcium ion	Ca	3
L04	6-(4'-fluoro-biphenyl-4-yl)-4-(3-methyl-1-phenylcarbamoyl-butylcarbamoyl)-2-[4-…	C43 H48 F N3 O5	1

Primary citation

Inhibition of stromelysin-1 (MMP-3) by P1'-biphenylylethyl carboxyalkyl dipeptides. Esser, C.K., Bugianesi, R.L., Caldwell, C.G. et al. J Med Chem (1997) 40:1026-1040. DOI 10.1021/jm960465t · PubMed

Other PDB entries of the same protein (UniProt P08254 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1HY7 1.5 Å, A carboxylic acid based inhibitor in complex with MMP3
1CIZ 1.64 Å, X-ray structure of human stromelysin catalytic domain complexes with non-peptide…
1CAQ 1.8 Å, X-ray structure of human stromelysin catalytic domain complexes with non-peptide…
1USN 1.8 Å, Crystal structure of the catalytic domain of human fibroblast stromelysin-1 inhibited…
1C3I 1.83 Å, Human stromelysin-1 catalytic domain complexed with ro-26-2812
4G9L 1.88 Å, Structure of MMP3 complexed with NNGH inhibitor.
1G49 1.9 Å, A carboxylic acid based inhibitor in complex with MMP3
1SLM 1.9 Å, Crystal structure of fibroblast stromelysin-1: the C-truncated human proenzyme
4DPE 1.96 Å, Structure of MMP3 complexed with a platinum-based inhibitor.
4JA1 1.96 Å, Structure of MMP3 complexed with a platinum-based inhibitor
1B8Y 2.0 Å, X-ray structure of human stromelysin catalytic domain complexed with non-peptide…
1CQR 2.0 Å, Crystal structure of the stromelysin catalytic domain at 2.0 a resolution

Browse structure collections

About this viewer

MolViewer shows 1HFS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.