Structural basis for the specific interaction of lysine-containing proline-rich peptides with the N-terminal SH3 domain of C-crk. Determined by X-ray diffraction at 1.9 Å resolution. Released 8 May 1995.
Explore 1CKB in 3D Show helices and sheets RCSB PDB PDBe
1CKB contains 2 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 136-139 | 4 | 1 |
| β-strand | 143 | 1 | 2 |
| β-strand | 150 | 1 | 1 |
| β-strand | 153 | 1 | 2 |
| β-strand | 158-163 | 6 | 1 |
| β-strand | 169-173 | 5 | 1 |
| β-strand | 179-183 | 5 | 1 |
| α-helix | 184-186 | 3 | |
| β-strand | 187-188 | 2 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-6 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| C-crk N-terminal SH3 domain | A | protein | 57 | Mus musculus | Q64010 (AlphaFold model) |
| Sos peptide (pro-pro-pro-val-pro-pro-arg-arg-arg-arg) | B | protein | 10 | Homo sapiens |
>1CKB_1 C-CRK N-TERMINAL SH3 DOMAIN (chains A) AEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKY
>1CKB_2 SOS PEPTIDE (PRO-PRO-PRO-VAL-PRO-PRO-ARG-ARG-ARG-ARG) (chains B) PPPVPPRRRR
Structural basis for the specific interaction of lysine-containing proline-rich peptides with the N-terminal SH3 domain of c-Crk. Wu, X., Knudsen, B., Feller, S.M. et al. Structure (1995) 3:215-226. DOI 10.1016/S0969-2126(01)00151-4 · PubMed
Other PDB entries of the same protein (UniProt Q64010 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1CKB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.