1CQM: Ribosomal protein S6

Name: PDB 1CQM: Protein aggregation and alzheimer's disease: crystallographic analysis of the phenomenon. Engineered version of the ribosomal protein S6 used as a stable scaffold to study oligomerization.
Published: 2000-09-08
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ribosomal protein

Protein aggregation and alzheimer's disease: crystallographic analysis of the phenomenon. Engineered version of the ribosomal protein S6 used as a stable scaffold to study oligomerization. Determined by X-ray diffraction at 1.65 Å resolution. Released 8 Sept 2000.

Method: X-ray diffraction
Resolution: 1.65 Å
Organism: Thermus thermophilus
Chains: 2
Atoms: 1,794
Mol. weight: 23.83 kDa
Released: 8 Sept 2000

Explore 1CQM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1CQM contains 5 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	2-10	9	1
α-helix	16-32	17
β-strand	36-52	17	1
β-strand	55-67	13	1
α-helix	69-80	12
β-strand	85-92	8	1

Chain B: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	2-10	9	2
α-helix	16-32	17
β-strand	36-52	17	2
β-strand	55-67	13	2
α-helix	69-71	3
α-helix	72-80	9
β-strand	85-92	8	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ribosomal protein S6	A, B	protein	101	Thermus thermophilus	Q5SLP8 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1CQM_1 RIBOSOMAL PROTEIN S6 (chains A, B)
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVAILGLRRLAYPIAKDPQGYF
LWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA

Primary citation

Designed protein tetramer zipped together with a hydrophobic Alzheimer homology: a structural clue to amyloid assembly. Otzen, D.E., Kristensen, O., Oliveberg, M. Proc Natl Acad Sci U S A (2000) 97:9907-9912. DOI 10.1073/pnas.160086297 · PubMed

Other PDB entries of the same protein (UniProt Q5SLP8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3ZZP 0.96 Å, Circular permutant of ribosomal protein S6, lacking edge strand beta- 2 of wild-type S6.
6I69 1.2 Å, Circular permutant of ribosomal protein S6, adding 5aa to C terminal of P97-3, L10A mutant
6I6E 1.2 Å, Circular permutant of ribosomal protein S6, swap strand 1 , L10A mutant
6I6S 1.46 Å, Circular permutant of ribosomal protein S6, adding 9aa to C terminal of P68-69, L75A…
6I6W 1.49 Å, Circular permutant of ribosomal protein S6, adding 6aa to C terminal of P68-69
6I6I 1.5 Å, Circular permutant of ribosomal protein S6, adding 6aa to C terminal of P68-69, L75A…
6I6U 1.57 Å, Circular permutant of ribosomal protein S6, adding 9aa to N terminal of P81-82, L75A…
7OS7 1.65 Å, Circular permutant of ribosomal protein S6, swap helix 2, L75A, A92K mutant
7BFF 1.66 Å, Circular permutant of ribosomal protein S6, P54-55 truncated, I25A mutant.
7B8V 1.86 Å, Circular permutant of ribosomal protein S6, P54-55
6I6O 1.9 Å, Circular permutant of ribosomal protein S6, swap helix 2, L75A mutant
7BFE 1.95 Å, Circular permutant of ribosomal protein S6, P54-55 truncated, L21A mutant.

Browse structure collections

About this viewer

MolViewer shows 1CQM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.