The mmp-inhibitory, N-terminal domain of human tissue inhibitor of metalloproteinases-1 (N-timp-1), solution NMR, 29 structures. Determined by solution NMR. Released 22 Dec 1999.
Explore 1D2B in 3D Show helices and sheets RCSB PDB PDBe
1D2B contains 6 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 8 | 1 | |
| α-helix | 9-14 | 6 | |
| β-strand | 18-23 | 6 | 1 |
| β-strand | 28-29 | 2 | 2 |
| β-strand | 35-39 | 5 | 2 |
| β-strand | 40-47 | 8 | 1 |
| α-helix | 49-51 | 3 | |
| β-strand | 60-64 | 5 | 2 |
| β-strand | 84-86 | 3 | 1 |
| β-strand | 89-90 | 2 | 2 |
| β-strand | 93-95 | 3 | 2 |
| β-strand | 102-103 | 2 | 1 |
| α-helix | 105-107 | 3 | |
| α-helix | 110-114 | 5 | |
| α-helix | 115-119 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Metalloproteinase inhibitor 1 | A | protein | 126 | Homo sapiens | P01033 (AlphaFold model) |
>1D2B_1 Metalloproteinase inhibitor 1 (chains A) CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRF VYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTY TVGCEE
NMR structure of tissue inhibitor of metalloproteinases-1 implicates localized induced fit in recognition of matrix metalloproteinases. Wu, B., Arumugam, S., Gao, G. et al. J Mol Biol (2000) 295:257-268. DOI 10.1006/jmbi.1999.3362 · PubMed
Other PDB entries of the same protein (UniProt P01033 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1D2B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.