1D2N: N-ethylmaleimide-sensitive fusion protein

Name: PDB 1D2N: D2 domain of N-ethylmaleimide-sensitive fusion protein
Published: 1998-10-14
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: hexamerization domain

D2 domain of N-ethylmaleimide-sensitive fusion protein. Determined by X-ray diffraction at 1.75 Å resolution. Released 14 Oct 1998.

Method: X-ray diffraction
Resolution: 1.75 Å
Organism: Cricetulus griseus
Chains: 1
Atoms: 2,262
Mol. weight: 31.16 kDa
Ligands: ANP, MG
Released: 14 Oct 1998

Explore 1D2N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1D2N contains 14 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	520-538	19
β-strand	544-550	7	1
α-helix	557-568	12
β-strand	572-576	5	1
α-helix	578-580	3
α-helix	586-601	16
β-strand	605-610	6	1
α-helix	613-616	4
β-strand	620	1	2
β-strand	625	1	2
α-helix	628-637	10
α-helix	641-642	2
β-strand	647-654	8	1
α-helix	657-662	6
β-strand	671-674	4	1
α-helix	676-677	2
β-strand	678-680	3	3
α-helix	681-691	11
α-helix	696-706	11
β-strand	710-713	4	3
α-helix	715-725	11
α-helix	730-732	3
α-helix	733-743	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
N-ethylmaleimide-sensitive fusion protein	A	protein	272	Cricetulus griseus	P18708 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1D2N_1 N-ETHYLMALEIMIDE-SENSITIVE FUSION PROTEIN (chains A)
MRGSHHHHHHGSTMDIKPAFGTNQEDYASYIMNGIIKWGDPVTRVLDDGELLVQQTKNSD
RTPLVSVLLEGPPHSGKTALAAKIAEESNFPFIKICSPDKMIGFSETAKCQAMKKIFDDA
YKSQLSCVVVDDIERLLDYVPIGPRFSNLVLQALLVLLKKAPPQGRKLLIIGTTSRKDVL
QEMEMLNAFSTTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKGKKVWIGIKKLLM
LIEMSLQMDPEYRVRKFLALLREEGASPLDFK

Ligands and cofactors

ID	Name	Formula	Copies
ANP	Phosphoaminophosphonic acid-adenylate ester	C10 H17 N6 O12 P3	1
MG	Magnesium ion	Mg	1

Water and common crystallization additives (GOL) are not listed.

Primary citation

Crystal structure of the hexamerization domain of N-ethylmaleimide-sensitive fusion protein. Lenzen, C.U., Steinmann, D., Whiteheart, S.W. et al. Cell (1998) 94:525-536. DOI 10.1016/S0092-8674(00)81593-7 · PubMed

Other PDB entries of the same protein (UniProt P18708 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1NSF 1.9 Å, D2 hexamerization domain of N-ethylmaleimide sensitive factor (NSF)
1QCS 1.9 Å, N-terminal domain of N-ethylmaleimide sensitive factor (NSF)
1QDN 2.3 Å, Amino terminal domain of the N-ethylmaleimide sensitive fusion protein (NSF)
9OJR 2.95 Å, 21bin20S complex (NSF-alphaSNAP-2:1 syntaxin-1a:SNAP-25), non-hydrolyzing, class 3
9OJU 2.97 Å, 21bin20S complex (NSF-alphaSNAP-2:1 syntaxin-1a:SNAP-25), non-hydrolyzing, class 4
9PFF 3.09 Å, Min22bin20S complex (NSF-alphaSNAP-2:2 syntaxin-1a H3:SNAP-25 SN1), non-hydrolyzing,…
9PFC 3.15 Å, NSF, substrate free, hydrolyzing, class 26
9OK5 3.29 Å, 22bin20S complex (NSF-alphaSNAP-2:2 syntaxin-1a:SNAP-25), hydrolyzing, class 16
9OJZ 3.39 Å, 21bin20S complex (NSF-alphaSNAP-2:1 syntaxin-1a:SNAP-25), non-hydrolyzing, class 5
9PB9 3.45 Å, 21bin20S complex (NSF-alphaSNAP-2:1 syntaxin-1a:SNAP-25), non-hydrolyzing, class 8
9PBA 3.47 Å, 21bin20S complex (NSF-alphaSNAP-2:1 syntaxin-1a:SNAP-25), non-hydrolyzing, class 9
9OLJ 3.52 Å, 22bin20S complex (NSF-alphaSNAP-2:2 syntaxin-1a:SNAP-25), hydrolyzing, class 18

Browse structure collections

About this viewer

MolViewer shows 1D2N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.