1D5V: S12 transcription factor

Solution structure of the forkhead domain of the adipocyte-transcription factor freac-11 (S12). Determined by solution NMR. Released 11 Oct 2000.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 780
Mol. weight: 11.08 kDa
Released: 11 Oct 2000

Explore 1D5V in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1D5V contains 4 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	9-18	10
β-strand	25	1	1
α-helix	27-37	11
α-helix	40-43	4
α-helix	48-58	11
β-strand	62-64	3	1
β-strand	78-80	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
S12 transcription factor (fkh-14)	A	protein	94	Homo sapiens	Q99958 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1D5V_1 S12 TRANSCRIPTION FACTOR (FKH-14) (chains A)
MLVKPPYSYIALITMAIQNAPEKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLSLNE
CFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFL

Primary citation

Solution structure and dynamics of the DNA-binding domain of the adipocyte-transcription factor FREAC-11. van Dongen, M.J., Cederberg, A., Carlsson, P. et al. J Mol Biol (2000) 296:351-359. DOI 10.1006/jmbi.1999.3476 · PubMed

Other PDB entries of the same protein (UniProt Q99958 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6AKP 2.32 Å, Crystal Structural of FOXC2 DNA binding domain bound to PC promoter
6AKO 2.4 Å, Crystal Structure of FOXC2 DBD Bound to DBE2 DNA
9VRT 2.64 Å, Crystal structure of FOXC2/NFAT1 complex bound to ARRE2-P DNA
9VS2 2.65 Å, Crystal structure of FOXC2/NFAT1 complex bound to ARRE3-P DNA
9VRQ 2.8 Å, Crystal structure of FOXC2/NFAT1 complex bound to ARRE2 DNA
6LBM 2.84 Å, Crystal Structure of FOXC2-DBD bound to a palindromic DNA sequence
6O3T 3.06 Å, Structural basis of FOXC2 and DNA interactions

Browse structure collections

About this viewer

MolViewer shows 1D5V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.