6O3T: FOXC2 and DNA interactions

Structural basis of FOXC2 and DNA interactions. Determined by X-ray diffraction at 3.06 Å resolution. Released 15 Jan 2020.

Method: X-ray diffraction
Resolution: 3.06 Å
Organisms: Homo sapiens, synthetic construct
Chains: 4
Atoms: 2,197
Mol. weight: 35.42 kDa
Released: 15 Jan 2020

Explore 6O3T in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6O3T contains 8 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	77-87	11
β-strand	93-94	2	1
α-helix	95-105	11
α-helix	107-110	4
α-helix	114-126	13
β-strand	130-133	4	1
β-strand	145-148	4	1

Chain B: 4 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	77-86	10
β-strand	93-94	2	2
α-helix	95-105	11
α-helix	107-109	3
α-helix	116-126	11
β-strand	131-133	3	2
β-strand	145-147	3	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Forkhead box protein C2	A, B	protein	95	Homo sapiens	Q99958 (AlphaFold model)
DNA (5'-d(apapaptptpgptptptpaptpapapapcpapgpcpcpcp*g)-3')	C	DNA	21	synthetic construct
DNA (5'-d(tptpcpgpgpgpcptpgptptptpaptpapapapcpapap*t)-3')	D	DNA	21	synthetic construct

Sequence of entity 1 (A, B), FASTA

>6O3T_1 Forkhead box protein C2 (chains A, B)
LVKPPYSYIALITMAIQNAPEKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLSLNEC
FVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRR

Sequence of entity 2 (C), FASTA

>6O3T_2 DNA (5'-D(*AP*AP*AP*TP*TP*GP*TP*TP*TP*AP*TP*AP*AP*AP*CP*AP*GP*CP*CP*CP*G)-3') (chains C)
AAATTGTTTATAAACAGCCCG

Sequence of entity 3 (D), FASTA

>6O3T_3 DNA (5'-D(*TP*TP*CP*GP*GP*GP*CP*TP*GP*TP*TP*TP*AP*TP*AP*AP*AP*CP*AP*AP*T)-3') (chains D)
TTCGGGCTGTTTATAAACAAT

Primary citation

Crystal Structure of FOXC2 in Complex with DNA Target. Li, S., Pradhan, L., Ashur, S. et al. ACS Omega (2019) 4:10906-10914. DOI 10.1021/acsomega.9b00756 · PubMed

Other PDB entries of the same protein (UniProt Q99958 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6AKP 2.32 Å, Crystal Structural of FOXC2 DNA binding domain bound to PC promoter
6AKO 2.4 Å, Crystal Structure of FOXC2 DBD Bound to DBE2 DNA
9VRT 2.64 Å, Crystal structure of FOXC2/NFAT1 complex bound to ARRE2-P DNA
9VS2 2.65 Å, Crystal structure of FOXC2/NFAT1 complex bound to ARRE3-P DNA
9VRQ 2.8 Å, Crystal structure of FOXC2/NFAT1 complex bound to ARRE2 DNA
6LBM 2.84 Å, Crystal Structure of FOXC2-DBD bound to a palindromic DNA sequence
1D5V Solution structure of the forkhead domain of the adipocyte-transcription factor freac-11…

Browse structure collections

About this viewer

MolViewer shows 6O3T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.