6LBM: FOXC2-DBD

Name: PDB 6LBM: Crystal Structure of FOXC2-DBD bound to a palindromic DNA sequence
Published: 2021-02-10
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Crystal Structure of FOXC2-DBD bound to a palindromic DNA sequence. Determined by X-ray diffraction at 2.84 Å resolution. Released 10 Feb 2021.

Method: X-ray diffraction
Resolution: 2.84 Å
Organism: Homo sapiens
Chains: 3
Atoms: 1,393
Mol. weight: 24.62 kDa
Ligands: MG
Released: 10 Feb 2021

Explore 6LBM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6LBM contains 6 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain C: 6 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	77-87	11
β-strand	93	1	1
α-helix	95-105	11
α-helix	107-110	4
α-helix	113-126	14
β-strand	130-133	4	1
β-strand	145-148	4	1
α-helix	150-152	3
α-helix	164-166	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Forkhead box protein C2	C	protein	103	Homo sapiens	Q99958 (AlphaFold model)
IRE0	A, B	DNA	20	Homo sapiens

Sequence of entity 1 (C), FASTA

>6LBM_1 Forkhead box protein C2 (chains C)
GPKPPYSYIALITMAIQNAPEKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLSLNEC
FVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKD

Sequence of entity 2 (A, B), FASTA

>6LBM_2 IRE0 (chains A, B)
GGTGTAAACATGTTTACACC

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1

Primary citation

Mechanism of forkhead transcription factors binding to a novel palindromic DNA site. Li, J., Dai, S., Chen, X. et al. Nucleic Acids Res (2021) 49:3573-3583. DOI 10.1093/nar/gkab086 · PubMed

Other PDB entries of the same protein (UniProt Q99958 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6AKP 2.32 Å, Crystal Structural of FOXC2 DNA binding domain bound to PC promoter
6AKO 2.4 Å, Crystal Structure of FOXC2 DBD Bound to DBE2 DNA
9VRT 2.64 Å, Crystal structure of FOXC2/NFAT1 complex bound to ARRE2-P DNA
9VS2 2.65 Å, Crystal structure of FOXC2/NFAT1 complex bound to ARRE3-P DNA
9VRQ 2.8 Å, Crystal structure of FOXC2/NFAT1 complex bound to ARRE2 DNA
6O3T 3.06 Å, Structural basis of FOXC2 and DNA interactions
1D5V Solution structure of the forkhead domain of the adipocyte-transcription factor freac-11…

Browse structure collections

About this viewer

MolViewer shows 6LBM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.