1DF4: HIV-1 envelope glycoprotein GP41

Interactions between HIV-1 GP41 core and detergents and their implications for membrane fusion. Determined by X-ray diffraction at 1.45 Å resolution. Released 24 Nov 1999.

Method: X-ray diffraction
Resolution: 1.45 Å
Organism: Human immunodeficiency virus 1
Chains: 1
Atoms: 540
Mol. weight: 7.88 kDa
Released: 24 Nov 1999

Explore 1DF4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1DF4 contains 2 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	4-32	29
α-helix	42-63	22

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
HIV-1 envelope glycoprotein GP41	A	protein	68	Human immunodeficiency virus 1	P04578 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1DF4_1 HIV-1 ENVELOPE GLYCOPROTEIN GP41 (chains A)
SGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARSGGRGGWMEWDREINNYTSLIHSLIE
ESQNQQEK

Primary citation

Interactions between HIV-1 gp41 core and detergents and their implications for membrane fusion. Shu, W., Ji, H., Lu, M. J Biol Chem (2000) 275:1839-1845. DOI 10.1074/jbc.275.3.1839 · PubMed

Other PDB entries of the same protein (UniProt P04578 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8F3A 1.2 Å, HIV-1 gp41 coiled-coil pocket IQN17
6UCF 1.29 Å, N123-VRC34_pI4 HIV neutralizing antibody in complex with HIV fusion peptide residue…
6PSA 1.3 Å, PIE12 D-peptide against HIV entry (in complex with IQN17 Q577R resistance mutant)
6UCE 1.38 Å, N123-VRC34_pI3 HIV neutralizing antibody in complex with HIV fusion peptide residue…
9ARN 1.41 Å, Structure and interactions of HIV-1 gp41 CHR-NHR reverse hairpin constructs reveal…
6BXP 1.45 Å, Crystal Structure of HLA-B*57:01 with a modified HIV peptide RKV-Kyn
7EKB 1.45 Å, Crystal structure of 4E10 modified with pyrene acetamide
5X08 1.49 Å, Crystal structure of broadly neutralizing anti-HIV-1 antibody 4E10, mutant Npro, with…
6JQK 1.5 Å, Structure of C34M/N36
5TKK 1.55 Å, Structure of mouse vaccination-elicited HIV neutralizing antibody vFP5.01 in complex…
6PDR 1.55 Å, Vaccine-elicited murine FP-targeting antibody vFP25.18 in complex with HIV fusion…
6BXQ 1.58 Å, Crystal Structure of HLA-B*57:01 with an HIV peptide RKV

Browse structure collections

About this viewer

MolViewer shows 1DF4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.