X-ray structure of escherichia coli enoyl reductase with bound NAD and thieno-diazaborine. Determined by X-ray diffraction at 2.2 Å resolution. Released 28 Jan 1998.
Explore 1DFH in 3D Show helices and sheets RCSB PDB PDBe
1DFH contains 36 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8-11 | 4 | 1 |
| α-helix | 20-30 | 11 | |
| β-strand | 34-39 | 6 | 1 |
| α-helix | 42-54 | 13 | |
| β-strand | 60-62 | 3 | 1 |
| α-helix | 68-79 | 12 | |
| β-strand | 85-90 | 6 | 1 |
| α-helix | 97-100 | 4 | |
| α-helix | 104-107 | 4 | |
| α-helix | 110-117 | 8 | |
| α-helix | 118-122 | 5 | |
| α-helix | 123-131 | 9 | |
| α-helix | 132-134 | 3 | |
| β-strand | 135-145 | 11 | 1 |
| α-helix | 147-149 | 3 | |
| α-helix | 158-177 | 20 | |
| α-helix | 178-180 | 3 | |
| β-strand | 182-189 | 8 | 1 |
| α-helix | 190-191 | 2 | |
| α-helix | 197-198 | 2 | |
| α-helix | 203-213 | 11 | |
| α-helix | 222-233 | 12 | |
| α-helix | 235-237 | 3 | |
| β-strand | 244-247 | 4 | 1 |
| α-helix | 251-253 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8-11 | 4 | 2 |
| α-helix | 20-30 | 11 | |
| β-strand | 34-39 | 6 | 2 |
| α-helix | 42-54 | 13 | |
| β-strand | 60-62 | 3 | 2 |
| α-helix | 68-81 | 14 | |
| β-strand | 85 | 1 | 3 |
| β-strand | 88-90 | 3 | 2 |
| α-helix | 97-100 | 4 | |
| α-helix | 104-107 | 4 | |
| α-helix | 110-117 | 8 | |
| α-helix | 118-122 | 5 | |
| α-helix | 123-131 | 9 | |
| α-helix | 132-134 | 3 | |
| β-strand | 135 | 1 | 3 |
| α-helix | 136 | 1 | |
| β-strand | 139-145 | 7 | 2 |
| α-helix | 147-149 | 3 | |
| α-helix | 158-177 | 20 | |
| α-helix | 178-180 | 3 | |
| β-strand | 182-189 | 8 | 2 |
| α-helix | 190-191 | 2 | |
| α-helix | 203-213 | 11 | |
| α-helix | 222-232 | 11 | |
| α-helix | 235-237 | 3 | |
| β-strand | 244-247 | 4 | 2 |
| α-helix | 251-253 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Enoyl acyl carrier protein reductase | A, B | protein | 261 | Escherichia coli | P0AEK4 (AlphaFold model) |
>1DFH_1 ENOYL ACYL CARRIER PROTEIN REDUCTASE (chains A, B) GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVL QCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISS YSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEG VRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGIS GEVVHVDGGFSIAAMNELELK
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAD | Nicotinamide-adenine-dinucleotide | C21 H27 N7 O14 P2 | 2 |
| TDB | 6-methyl-2(PROPANE-1-sulfonyl)-2H-THIENO[3,2-D][1,2,3]DIAZABORININ-1-ol | C9 H13 B N2 O3 S2 | 2 |
A mechanism of drug action revealed by structural studies of enoyl reductase. Baldock, C., Rafferty, J.B., Sedelnikova, S.E. et al. Science (1996) 274:2107-2110. DOI 10.1126/science.274.5295.2107 · PubMed
Other PDB entries of the same protein (UniProt P0AEK4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1DFH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.