1DIV: Ribosomal protein L9

Name: PDB 1DIV: Ribosomal protein L9
Published: 1997-01-11
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ribosomal protein

Ribosomal protein L9. Determined by X-ray diffraction at 2.6 Å resolution. Released 11 Jan 1997.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Geobacillus stearothermophilus
Chains: 1
Atoms: 1,148
Mol. weight: 16.34 kDa
Released: 11 Jan 1997

Explore 1DIV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1DIV contains 9 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	1
β-strand	8-9	2	2
β-strand	11-12	2	2
α-helix	13-15	3
β-strand	17-20	4	1
α-helix	21-22	2
α-helix	25	1
α-helix	26-30	5
β-strand	36-38	3	1
α-helix	41-72	32
β-strand	77-81	5	3
β-strand	83	1	4
α-helix	85-87	3
β-strand	88-93	6	5
α-helix	95-106	12
α-helix	112-114	3
β-strand	115	1	3
α-helix	120	1
β-strand	121-123	3	5
β-strand	125-134	10	3
β-strand	137-147	11	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ribosomal protein L9	A	protein	149	Geobacillus stearothermophilus	P02417 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1DIV_1 RIBOSOMAL PROTEIN L9 (chains A)
MKVIFLKDVKGKGKKGEIKNVADGYANNFLFKQGLAIEATPANLKALEAQKQKEQRQAAE
ELANAKKLKEQLEKLTVTIPAKAGEGGRLFGSITSKQIAESLQAQHGLKLDKRKIELADA
IRALGYTNVPVKLHPEVTATLKVHVTEQK

Primary citation

Crystal structure of prokaryotic ribosomal protein L9: a bi-lobed RNA-binding protein. Hoffman, D.W., Davies, C., Gerchman, S.E. et al. EMBO J (1994) 13:205-212. PubMed

Other PDB entries of the same protein (UniProt P02417 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2HBA 1.25 Å, Crystal Structure of N-terminal Domain of Ribosomal Protein L9 (NTL9) K12M
2HVF 1.57 Å, Crystal Structure of N-terminal Domain of Ribosomal Protein L9 (NTL9), G34dA
2HBB 1.9 Å, Crystal Structure of the N-terminal Domain of Ribosomal Protein L9 (NTL9)
4V42 5.5 Å, Crystal structure of the ribosome at 5.5 A resolution.
4V4R 5.9 Å, Crystal structure of the whole ribosomal complex.
4V4T 6.46 Å, Crystal structure of the whole ribosomal complex with a stop codon in the A-site.
4V4S 6.76 Å, Crystal structure of the whole ribosomal complex.
487D 7.5 Å, Seven ribosomal proteins fitted to a CRYO-electron microscopic map of the large 50S…
1CQU Solution structure of the N-terminal domain of ribosomal protein L9

Browse structure collections

About this viewer

MolViewer shows 1DIV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.