2HBB: N-terminal Domain of Ribosomal Protein L9

Crystal Structure of the N-terminal Domain of Ribosomal Protein L9 (NTL9). Determined by X-ray diffraction at 1.9 Å resolution. Released 29 May 2007.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Geobacillus stearothermophilus
Chains: 1
Atoms: 446
Mol. weight: 5.82 kDa
Ligands: ZN
Released: 29 May 2007

Explore 2HBB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2HBB contains 3 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	1
β-strand	9	1	2
β-strand	13	1	2
β-strand	18-20	3	1
α-helix	23-25	3
α-helix	26-30	5
β-strand	36-38	3	1
α-helix	41-50	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
50S ribosomal protein L9	A	protein	51	Geobacillus stearothermophilus	P02417 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2HBB_1 50S ribosomal protein L9 (chains A)
MKVIFLKDVKGKGKKGEIKNVADGYANNFLFKQGLAIEATPANLKALEAQK

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	4

Primary citation

Energetically significant networks of coupled interactions within an unfolded protein. Cho, J.H., Meng, W., Sato, S. et al. Proc Natl Acad Sci U S A (2014) 111:12079-12084. DOI 10.1073/pnas.1402054111 · PubMed

Other PDB entries of the same protein (UniProt P02417 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2HBA 1.25 Å, Crystal Structure of N-terminal Domain of Ribosomal Protein L9 (NTL9) K12M
2HVF 1.57 Å, Crystal Structure of N-terminal Domain of Ribosomal Protein L9 (NTL9), G34dA
1DIV 2.6 Å, Ribosomal protein L9
4V42 5.5 Å, Crystal structure of the ribosome at 5.5 A resolution.
4V4R 5.9 Å, Crystal structure of the whole ribosomal complex.
4V4T 6.46 Å, Crystal structure of the whole ribosomal complex with a stop codon in the A-site.
4V4S 6.76 Å, Crystal structure of the whole ribosomal complex.
487D 7.5 Å, Seven ribosomal proteins fitted to a CRYO-electron microscopic map of the large 50S…
1CQU Solution structure of the N-terminal domain of ribosomal protein L9

Browse structure collections

About this viewer

MolViewer shows 2HBB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.