2HVF: 50S ribosomal protein L9

Crystal Structure of N-terminal Domain of Ribosomal Protein L9 (NTL9), G34dA. Determined by X-ray diffraction at 1.57 Å resolution. Released 12 Jun 2007.

Method: X-ray diffraction
Resolution: 1.57 Å
Chains: 1
Atoms: 494
Mol. weight: 6.23 kDa
Ligands: ZN
Released: 12 Jun 2007

Explore 2HVF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2HVF contains 4 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	2-5	4	1
β-strand	9	1	2
β-strand	13	1	2
β-strand	18-20	3	1
α-helix	23-25	3
α-helix	26-30	5
α-helix	31-33	3
β-strand	36-38	3	1
α-helix	41-51	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
50S ribosomal protein L9	A	protein	52		P02417 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2HVF_1 50S ribosomal protein L9 (chains A)
MKVIFLKDVKGKGKKGEIKNVADGYANNFLFKQALAIEATPANLKALEAQKQ

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	4

Water and common crystallization additives (ACY, IMD, CL) are not listed.

Primary citation

Detecting and quantifying strain in protein folding. Anil, B., Kim, E.Y., Cho, J.H. et al. To be published.

Other PDB entries of the same protein (UniProt P02417 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2HBA 1.25 Å, Crystal Structure of N-terminal Domain of Ribosomal Protein L9 (NTL9) K12M
2HBB 1.9 Å, Crystal Structure of the N-terminal Domain of Ribosomal Protein L9 (NTL9)
1DIV 2.6 Å, Ribosomal protein L9
4V42 5.5 Å, Crystal structure of the ribosome at 5.5 A resolution.
4V4R 5.9 Å, Crystal structure of the whole ribosomal complex.
4V4T 6.46 Å, Crystal structure of the whole ribosomal complex with a stop codon in the A-site.
4V4S 6.76 Å, Crystal structure of the whole ribosomal complex.
487D 7.5 Å, Seven ribosomal proteins fitted to a CRYO-electron microscopic map of the large 50S…
1CQU Solution structure of the N-terminal domain of ribosomal protein L9

Browse structure collections

About this viewer

MolViewer shows 2HVF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.