1DUJ: Spindle assembly checkpoint protein human MAD2

Solution structure of the spindle assembly checkpoint protein human MAD2. Determined by solution NMR. Released 8 Mar 2000.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,510
Mol. weight: 21.43 kDa
Released: 8 Mar 2000

Explore 1DUJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1DUJ contains 4 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	12-14	3	1
β-strand	17	1	2
α-helix	19-32	14
α-helix	33-37	5
β-strand	46-50	5	3
β-strand	53-57	5	3
α-helix	61-75	15
β-strand	85-92	8	1
β-strand	97-105	9	1
β-strand	108	1	2
α-helix	124-143	20
β-strand	151-160	10	1
β-strand	175-177	3	1
β-strand	187-195	9	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Spindle assembly checkpoint protein	A	protein	187	Homo sapiens	Q13257 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1DUJ_1 SPINDLE ASSEMBLY CHECKPOINT PROTEIN (chains A)
GSITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNV
VEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEI
RSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTT
TIHKVNS

Primary citation

Structure of the Mad2 spindle assembly checkpoint protein and its interaction with Cdc20. Luo, X., Fang, G., Coldiron, M. et al. Nat Struct Biol (2000) 7:224-229. DOI 10.1038/73338 · PubMed

Other PDB entries of the same protein (UniProt Q13257 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2VFX 1.95 Å, Structure of the Symmetric Mad2 Dimer
1GO4 2.05 Å, Crystal structure of Mad1-Mad2 reveals a conserved Mad2 binding motif in Mad1 and Cdc20.
2QYF 2.3 Å, Crystal structure of the Mad2/p31(comet)/Mad2-binding peptide ternary complex
2V64 2.9 Å, Crystallographic structure of the conformational dimer of the Spindle Assembly…
6TLJ 3.8 Å, Cryo-EM structure of the Anaphase-promoting complex/Cyclosome, in complex with the…
3GMH 3.95 Å, Crystal Structure of the Mad2 Dimer
5LCW 4.2 Å, Cryo-EM structure of the Anaphase-promoting complex/Cyclosome, in complex with the…
6F0X 4.6 Å, Cryo-EM structure of TRIP13 in complex with ATP gamma S, p31comet, C-Mad2 and Cdc20
5KHU 4.8 Å, Model of human Anaphase-promoting complex/Cyclosome (APC15 deletion mutant), in complex…
1KLQ The Mad2 Spindle Checkpoint Protein Undergoes Similar Major Conformational Changes upon…
1S2H The Mad2 spindle checkpoint protein possesses two distinct natively folded states

Browse structure collections

About this viewer

MolViewer shows 1DUJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.