1S2H: PDB entry 1S2H

The Mad2 spindle checkpoint protein possesses two distinct natively folded states. Determined by solution NMR. Released 30 Mar 2004.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,650
Mol. weight: 23.5 kDa
Released: 30 Mar 2004

Explore 1S2H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1S2H contains 7 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	13-31	19
α-helix	32-36	5
α-helix	40-42	3
β-strand	43-48	6	1
β-strand	51-56	6	1
α-helix	59-71	13
α-helix	72-76	5
β-strand	83-90	8	2
β-strand	95-106	12	2
α-helix	114-115	2
α-helix	121-141	21
β-strand	149-156	8	2
β-strand	178-187	10	2
β-strand	191-200	10	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mitotic spindle assembly checkpoint protein MAD2A	A	protein	206	Homo sapiens	Q13257 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1S2H_1 Mitotic spindle assembly checkpoint protein MAD2A (chains A)
GMALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDL
ELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREK
SQKAIQDEIRSVIAQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSE
EVRLRSFTTTIHKVNSMVAYKIPVND

Primary citation

The Mad2 spindle checkpoint protein has two distinct natively folded states. Luo, X., Tang, Z., Xia, G. et al. Nat Struct Mol Biol (2004) 11:338-345. DOI 10.1038/nsmb748 · PubMed

Other PDB entries of the same protein (UniProt Q13257 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2VFX 1.95 Å, Structure of the Symmetric Mad2 Dimer
1GO4 2.05 Å, Crystal structure of Mad1-Mad2 reveals a conserved Mad2 binding motif in Mad1 and Cdc20.
2QYF 2.3 Å, Crystal structure of the Mad2/p31(comet)/Mad2-binding peptide ternary complex
2V64 2.9 Å, Crystallographic structure of the conformational dimer of the Spindle Assembly…
6TLJ 3.8 Å, Cryo-EM structure of the Anaphase-promoting complex/Cyclosome, in complex with the…
3GMH 3.95 Å, Crystal Structure of the Mad2 Dimer
5LCW 4.2 Å, Cryo-EM structure of the Anaphase-promoting complex/Cyclosome, in complex with the…
6F0X 4.6 Å, Cryo-EM structure of TRIP13 in complex with ATP gamma S, p31comet, C-Mad2 and Cdc20
5KHU 4.8 Å, Model of human Anaphase-promoting complex/Cyclosome (APC15 deletion mutant), in complex…
1DUJ Solution structure of the spindle assembly checkpoint protein human MAD2
1KLQ The Mad2 Spindle Checkpoint Protein Undergoes Similar Major Conformational Changes upon…

Browse structure collections

About this viewer

MolViewer shows 1S2H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.