1DXS: P53-like transcription factor

Crystal structure of the C-terminal sterile alpha motif (SAM) domain of human p73 alpha splice variant. Determined by X-ray diffraction at 2.54 Å resolution. Released 12 Jan 2001.

Method: X-ray diffraction
Resolution: 2.54 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 467
Mol. weight: 9.03 kDa
Released: 12 Jan 2001

Explore 1DXS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1DXS contains 5 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	7-13	7
α-helix	20-24	5
α-helix	31-35	5
α-helix	39-44	6
α-helix	52-61	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
P53-like transcription factor	A	protein	80	HOMO SAPIENS	O15350 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1DXS_1 P53-LIKE TRANSCRIPTION FACTOR (chains A)
GSYHADPSLVSFLTGLGCPNCIEYFTSQGLQSIYHLQNLTIEDLGALKIPEQYRMTIWRG
LQDLKQGHDYSTAQQLLRSS

Primary citation

Structure of the C-Terminal Sterile Alpha-Motif (Sam) Domain of Human P73 Alpha. Wang, W.K., Bycroft, M., Foster, N.W. et al. Acta Crystallogr D Biol Crystallogr (2001) 57:545. DOI 10.1107/S0907444901002529 · PubMed

Other PDB entries of the same protein (UniProt O15350 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5HOB 1.22 Å, p73 homo-tetramerization domain mutant I
5HOC 1.36 Å, p73 homo-tetramerization domain mutant II
2WQI 1.7 Å, Crystal structure of the human p73 tetramerization domain
8P9C 1.76 Å, Crystal structure of p63-p73 heterotetramer (tetramerisation domain) in complex with…
9GNB 1.8 Å, Structure of p73 SAM domain in complex with DARPin B9
2XWC 1.82 Å, Crystal structure of the DNA binding domain of human TP73 refined at 1.8 A resolution
2WQJ 2.0 Å, Crystal structure of a truncated variant of the human p73 tetramerization domain
9GLQ 2.1 Å, Crystal structure of p73 tetramerisation domain in complex with darpins 1800
8P9E 2.25 Å, Crystal structure of wild type p63-p73 heterotetramer (tetramerisation domain) in…
4A63 2.27 Å, Crystal structure of the p73-ASPP2 complex at 2.6A resolution
2WTT 2.3 Å, Structure of the human p73 tetramerization domain (crystal form II)
8P9D 2.7 Å, Crystal structure of p63-p73 heterotetramer (tetramerisation domain) in complex with…

Browse structure collections

About this viewer

MolViewer shows 1DXS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.