8P9E: Wild type p63-p73 heterotetramer

Crystal structure of wild type p63-p73 heterotetramer (tetramerisation domain) in complex with darpin 1810 F11. Determined by X-ray diffraction at 2.25 Å resolution. Released 8 Nov 2023.

Method: X-ray diffraction
Resolution: 2.25 Å
Organisms: Homo sapiens, Lama glama
Chains: 3
Atoms: 2,103
Mol. weight: 30.38 kDa
Released: 8 Nov 2023

Explore 8P9E in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8P9E contains 17 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	358-360	3
α-helix	369-384	16
α-helix	385-387	3
α-helix	390-403	14

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	362-377	16
α-helix	378-380	3
α-helix	383-395	13

Chain C: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	3-14	12
α-helix	17-25	9
α-helix	40-47	8
α-helix	50-56	7
α-helix	73-80	8
α-helix	83-91	9
α-helix	106-113	8
α-helix	116-124	9
α-helix	139-145	7
α-helix	149-156	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Isoform 2 of Tumor protein 63	A	protein	61	Homo sapiens	Q9H3D4 (AlphaFold model)
Tumor protein p73	B	protein	50	Homo sapiens	O15350 (AlphaFold model)
Darpin 1810 F11	C	protein	159	Lama glama

Sequence of entity 1 (A), FASTA

>8P9E_1 Isoform 2 of Tumor protein 63 (chains A)
GSDDELLYLPVRGRETYEMLLKIKESLELMQYLPQHTIETYRQQQQQQHQHLLQKQTSIQ
S

Sequence of entity 2 (B), FASTA

>8P9E_2 Tumor protein p73 (chains B)
GSDEDTYYLQVRGRENFEILMKLKESLELMELVPQPLVDSYRQQQQLLQR

Sequence of entity 3 (C), FASTA

>8P9E_3 Darpin 1810 F11 (chains C)
GSDLGKKLLEAAQTGQDDEVRILMANGADVNAMDMVGMTPLHLAAVNGHLEIVEVLLKTS
ADVNAQDYQGETPLHLAAIWGHLEIVEVLLKAGADVNANDLVGHTPLHLAAWSGHLEIVE
VLLKHGADVNAQDKFGKTAFDISIDNGNEDIAEVLQKAA

Primary citation

DARPins detect the formation of hetero-tetramers of p63 and p73 in epithelial tissues and in squamous cell carcinoma. Strubel, A., Munick, P., Hartmann, O. et al. Cell Death Dis (2023) 14:674-674. DOI 10.1038/s41419-023-06213-0 · PubMed

Other PDB entries of the same protein (UniProt Q9H3D4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2Y9U 1.6 Å, Structural basis of p63a SAM domain mutants involved in AEC syndrome
8P9C 1.76 Å, Crystal structure of p63-p73 heterotetramer (tetramerisation domain) in complex with…
7Z72 1.8 Å, Crystal structure of p63 SAM in complex with darpin A5
7Z7E 1.8 Å, Crystal structure of p63 DNA binding domain in complex with inhibitory DARPin G4
7Z71 1.85 Å, Crystal structure of p63 DBD in complex with darpin C14
3ZY0 1.9 Å, Crystal structure of a truncated variant of the human p63 tetramerization domain lacking…
6RU8 1.92 Å, Crystal structure of Casein Kinase I delta (CK1d) in complex with triple phosphorylated…
6RU6 2.05 Å, Crystal structure of Casein Kinase I delta (CK1d) in complex with monophosphorylated p63…
6RU7 2.08 Å, Crystal structure of Casein Kinase I delta (CK1d) in complex with double phosphorylated…
3ZY1 2.15 Å, Crystal structure of the human p63 tetramerization domain
9N54 2.2 Å, Bipartite p63 NLS in complex with Importin Alpha 2
7Z73 2.27 Å, Crystal structure of p63 tetramerization domain in complex with darpin 8F1

Browse structure collections

About this viewer

MolViewer shows 8P9E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.