5HOC: P73 homo-tetramerization domain mutant II

p73 homo-tetramerization domain mutant II. Determined by X-ray diffraction at 1.36 Å resolution. Released 19 Oct 2016.

Method: X-ray diffraction
Resolution: 1.36 Å
Organism: Homo sapiens
Chains: 2
Atoms: 746
Mol. weight: 12.1 kDa
Released: 19 Oct 2016

Explore 5HOC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5HOC contains 4 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	355-360	6	1
α-helix	362-378	17
α-helix	383-396	14

Chain B: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	354-359	6	1
α-helix	362-378	17
α-helix	383-392	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tumor protein p73	A, B	protein	50	Homo sapiens	O15350 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5HOC_1 Tumor protein p73 (chains A, B)
GSDEDTYYLQVRGRRNFEILMELKRSLELMELVPQPLVDSYDQQQQLLQR

Primary citation

Mechanism of TAp73 inhibition by Delta Np63 and structural basis of p63/p73 hetero-tetramerization. Gebel, J., Luh, L.M., Coutandin, D. et al. Cell Death Differ (2016) 23:1930-1940. DOI 10.1038/cdd.2016.83 · PubMed

Other PDB entries of the same protein (UniProt O15350 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5HOB 1.22 Å, p73 homo-tetramerization domain mutant I
2WQI 1.7 Å, Crystal structure of the human p73 tetramerization domain
8P9C 1.76 Å, Crystal structure of p63-p73 heterotetramer (tetramerisation domain) in complex with…
9GNB 1.8 Å, Structure of p73 SAM domain in complex with DARPin B9
2XWC 1.82 Å, Crystal structure of the DNA binding domain of human TP73 refined at 1.8 A resolution
2WQJ 2.0 Å, Crystal structure of a truncated variant of the human p73 tetramerization domain
9GLQ 2.1 Å, Crystal structure of p73 tetramerisation domain in complex with darpins 1800
8P9E 2.25 Å, Crystal structure of wild type p63-p73 heterotetramer (tetramerisation domain) in…
4A63 2.27 Å, Crystal structure of the p73-ASPP2 complex at 2.6A resolution
2WTT 2.3 Å, Structure of the human p73 tetramerization domain (crystal form II)
1DXS 2.54 Å, Crystal structure of the C-terminal sterile alpha motif (SAM) domain of human p73 alpha…
8P9D 2.7 Å, Crystal structure of p63-p73 heterotetramer (tetramerisation domain) in complex with…

Browse structure collections

About this viewer

MolViewer shows 5HOC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.