1DXX: Dystrophin

N-terminal Actin-binding Domain of Human Dystrophin. Determined by X-ray diffraction at 2.6 Å resolution. Released 16 May 2000.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: HOMO SAPIENS
Chains: 4
Atoms: 7,622
Mol. weight: 113.84 kDa
Released: 16 May 2000

Explore 1DXX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1DXX contains 64 α-helices and 4 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C and D: 16 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	14-31	18
α-helix	48-58	11
α-helix	70-86	17
α-helix	96-100	5
α-helix	104-115	12
α-helix	116-120	5
α-helix	122-131	10
α-helix	136-148	13
α-helix	161-163	3
α-helix	167-176	10
α-helix	178-180	3
α-helix	183-187	5
α-helix	192-201	10
α-helix	202-206	5
α-helix	215-218	4
α-helix	225-236	12
β-strand	243-245	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Dystrophin	A, B, C, D	protein	246	HOMO SAPIENS	P11532 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>1DXX_1 DYSTROPHIN (chains A, B, C, D)
MLWWEEVEDSYEREDVQKKTFTKWVNAQFSKFGKQHIENLFSDLQDGRRLLDLLEGLTGQ
KLPKEKGSTRVHALNNVNKALRVLQNNNVDLVNIGSTDIVDGNHKLTLGLIWNIILHWQV
KNVMKNIMAGLQQTNSEKILLSWVRQSTRNYPQVNVINFTTSWSDGLALNALIHSHRPDL
FDWNSVVSQQSATQRLEHAFNIARYQLGIEKLLDPEDVDTTYPDKKSILMYITSLFQVLP
QQVSIE

Primary citation

The Structure of the N-Terminal Actin-Binding Domain of Human Dystrophin and How Mutations in This Domain May Cause Duchenne or Becker Muscular Dystrophy. Norwood, F.L., Sutherland-Smith, A.J., Keep, N.H. et al. Structure (2000) 8:481. DOI 10.1016/S0969-2126(00)00132-5 · PubMed

Other PDB entries of the same protein (UniProt P11532 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9D58 1.94 Å, Human Dystrophin tandem calponin homology actin-binding domain crystallized in a…
1EG3 2.0 Å, Structure of a dystrophin ww domain fragment in complex with a beta-dystroglycan peptide
1EG4 2.0 Å, Structure of a dystrophin ww domain fragment in complex with a beta-dystroglycan peptide
9EC1 2.14 Å, The Structure of Human Dystrophin Spectrin Repeat 24
3UUN 2.3 Å, Crystal Structure of N-terminal first spectrin repeat of dystrophin

Browse structure collections

About this viewer

MolViewer shows 1DXX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.