1EG4: Dystrophin ww domain fragment

Structure of a dystrophin ww domain fragment in complex with a beta-dystroglycan peptide. Determined by X-ray diffraction at 2.0 Å resolution. Released 23 Aug 2000.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,478
Mol. weight: 31.59 kDa
Released: 23 Aug 2000

Explore 1EG4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1EG4 contains 16 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	49-54	6
β-strand	61-65	5	1
β-strand	71-75	5	1
β-strand	80-82	3	1
α-helix	86-94	9
α-helix	95-98	4
α-helix	104-118	15
α-helix	121-123	3
α-helix	126-135	10
β-strand	144-146	3	2
α-helix	147-164	18
α-helix	171-186	16
β-strand	193-195	3	2
α-helix	196-205	10
α-helix	211-222	12
β-strand	229	1	3
α-helix	231-247	17
α-helix	251-254	4
α-helix	260-269	10
β-strand	276	1	3
α-helix	278-286	9
α-helix	294-304	11

Chain P: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	8-12	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-dystroglycan	P	protein	15		Q14118 (AlphaFold model)
Dystrophin	A	protein	261	Homo sapiens	P11532 (AlphaFold model)

Sequence of entity 1 (P), FASTA

>1EG4_1 BETA-DYSTROGLYCAN (chains P)
KNMTPYRSPPPYVPP

Sequence of entity 2 (A), FASTA

>1EG4_2 DYSTROPHIN (chains A)
GPASQHFLSTSVQGPWERAISPNKVPYYINHETQTTCWDHPKMTELYQSLADLNNVRFSA
YRTAMKLRRLQKALCLDLLSLSAACDALDQHNLKQNDQPMDILQIINCLTTIYDRLEQEH
NNLVNVPLCVDMCLNWLLNVYDTGRTGRIRVLSFKTGIISLCKAHLEDKYRYLFKQVASS
TGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNIEPSVRSCFQFANNKPEIEAALFLDWM
RLEPQSMVWLPVLHRVAAAET

Primary citation

Structure of a WW domain containing fragment of dystrophin in complex with beta-dystroglycan. Huang, X., Poy, F., Zhang, R. et al. Nat Struct Biol (2000) 7:634-638. DOI 10.1038/77923 · PubMed

Other PDB entries of the same protein (UniProt Q14118 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5GGP 1.6 Å, Crystal structure of N-terminal domain of human protein O-mannose…
5LLK 1.8 Å, Crystal structure of human alpha-dystroglycan
7E9K 2.05 Å, Crystal Structure of POMGNT2 in complex with UDP and mono-mannosyl peptide (379Man long…
7E9L 2.1 Å, Crystal Structure of POMGNT2 in complex with UDP and mono-mannosyl peptide (379Man short…
6JJY 2.3 Å, Crystal Structure of KIBRA and beta-Dystroglycan
8UF4 2.43 Å, Crystal structure of wildtype dystroglycan proteolytic domain (juxtamembrane domain)
2MK7 Tetra-O-GalNAc glycosylated mucin sequence from alpha dystroglycan mucin domain

Browse structure collections

About this viewer

MolViewer shows 1EG4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.