3UUN: N-terminal first spectrin repeat of dystrophin

Crystal Structure of N-terminal first spectrin repeat of dystrophin. Determined by X-ray diffraction at 2.3 Å resolution. Released 19 Sept 2012.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,866
Mol. weight: 27.28 kDa
Released: 19 Sept 2012

Explore 3UUN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3UUN contains 8 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	339-365	27
α-helix	368-369	2
α-helix	372-409	38
α-helix	414-452	39

Chain B: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	341-363	23
α-helix	368-369	2
α-helix	372-407	36
α-helix	414-451	38

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Dystrophin	A, B	protein	119	Homo sapiens	P11532 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3UUN_1 Dystrophin (chains A, B)
EVNLDRYQTALEEVLSWLLSAEDTLQAQGEISNDVEVVKDQFHTHEGYMMDLTAHQGRVG
NILQLGSKLIGTGKLSEDEETEVQEQMNLLNSRWECLRVASMEKQSNLHRVLMDLQNQK

Primary citation

The crystal structures of dystrophin and utrophin spectrin repeats: implications for domain boundaries. Muthu, M., Richardson, K.A., Sutherland-Smith, A.J. PLoS One (2012) 7:e40066-e40066. DOI 10.1371/journal.pone.0040066 · PubMed

Other PDB entries of the same protein (UniProt P11532 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9D58 1.94 Å, Human Dystrophin tandem calponin homology actin-binding domain crystallized in a…
1EG3 2.0 Å, Structure of a dystrophin ww domain fragment in complex with a beta-dystroglycan peptide
1EG4 2.0 Å, Structure of a dystrophin ww domain fragment in complex with a beta-dystroglycan peptide
9EC1 2.14 Å, The Structure of Human Dystrophin Spectrin Repeat 24
1DXX 2.6 Å, N-terminal Actin-binding Domain of Human Dystrophin

Browse structure collections

About this viewer

MolViewer shows 3UUN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.