9EC1: Human Dystrophin Spectrin Repeat 24

The Structure of Human Dystrophin Spectrin Repeat 24. Determined by X-ray diffraction at 2.14 Å resolution. Released 22 Apr 2026.

Method: X-ray diffraction
Resolution: 2.14 Å
Organism: Homo sapiens
Chains: 8
Atoms: 7,630
Mol. weight: 108.38 kDa
Released: 22 Apr 2026

Explore 9EC1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9EC1 contains 55 α-helices and 0 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	3-29	27
α-helix	31-33	3
α-helix	34-36	3
α-helix	39-41	3
α-helix	42-55	14
α-helix	59-75	17
α-helix	78-81	4
α-helix	82-116	35

Chain B: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	2-29	28
α-helix	31-33	3
α-helix	34-36	3
α-helix	39-41	3
α-helix	42-55	14
α-helix	59-76	18
α-helix	79-81	3
α-helix	82-115	34

Chain C: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	3-29	27
α-helix	31-33	3
α-helix	34-36	3
α-helix	39-55	17
α-helix	59-75	17
α-helix	78-81	4
α-helix	82-115	34

Chain D: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	3-29	27
α-helix	31-33	3
α-helix	34-36	3
α-helix	39-41	3
α-helix	42-55	14
α-helix	59-76	18
α-helix	82-116	35

Chain E: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	2-29	28
α-helix	31-33	3
α-helix	34-36	3
α-helix	39-41	3
α-helix	42-55	14
α-helix	59-76	18
α-helix	82-115	34

Chain F: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	3-29	27
α-helix	31-33	3
α-helix	34-36	3
α-helix	39-55	17
α-helix	59-75	17
α-helix	82-115	34

Chain G: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	3-29	27
α-helix	31-33	3
α-helix	34-36	3
α-helix	39-41	3
α-helix	42-55	14
α-helix	59-75	17
α-helix	82-115	34

Chain H: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	3-29	27
α-helix	31-33	3
α-helix	46-56	11
α-helix	59-75	17
α-helix	82-113	32

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Dystrophin	A, B, C, D, E, F, G, H	protein	117	Homo sapiens	P11532 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H), FASTA

>9EC1_1 Dystrophin (chains A, B, C, D, E, F, G, H)
STGLERLQELQEATDELDLKLRQAEVIKGSWQPVGDLLIDSLQDHLEKVKALRGEIAPLK
ENVSHVNDLARQLTTLGIQLSPYNLSTLEDLNTRWKLLQVAVEDRVRQLHEAHRDFG

Primary citation

The atomic structure of human dystrophin spectrin-like repeat 24. Streeter, O., Shi, K., Bui, H. et al. Acta Crystallogr F Struct Biol Commun (2026) 82:184-193. DOI 10.1107/S2053230X26003262 · PubMed

Other PDB entries of the same protein (UniProt P11532 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9D58 1.94 Å, Human Dystrophin tandem calponin homology actin-binding domain crystallized in a…
1EG3 2.0 Å, Structure of a dystrophin ww domain fragment in complex with a beta-dystroglycan peptide
1EG4 2.0 Å, Structure of a dystrophin ww domain fragment in complex with a beta-dystroglycan peptide
3UUN 2.3 Å, Crystal Structure of N-terminal first spectrin repeat of dystrophin
1DXX 2.6 Å, N-terminal Actin-binding Domain of Human Dystrophin

Browse structure collections

About this viewer

MolViewer shows 9EC1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.