1E3O: Oct-1 POU dimer

Name: PDB 1E3O: Crystal structure of Oct-1 POU dimer bound to MORE
Published: 2001-11-10
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Crystal structure of Oct-1 POU dimer bound to MORE. Determined by X-ray diffraction at 1.9 Å resolution. Released 10 Nov 2001.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 3
Atoms: 1,631
Mol. weight: 25.11 kDa
Released: 10 Nov 2001

Explore 1E3O in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1E3O contains 8 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain C: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	6-22	17
α-helix	27-38	12
α-helix	44-52	9
α-helix	57-74	18
α-helix	107-109	3
α-helix	110-122	13
α-helix	128-138	11
α-helix	142-156	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
5'-d(aptpgpcpaptpgpapgpgp*a)-3'	A	DNA	11	Homo sapiens
5'-d(tpcpcptpcpaptpgpcpap*t)-3'	B	DNA	11	Homo sapiens
Octamer-binding transcription factor 1	C	protein	160	Homo sapiens	P14859 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1E3O_1 5'-D(*AP*TP*GP*CP*AP*TP*GP*AP*GP*GP*A)-3' (chains A)
ATGCATGAGGA

Sequence of entity 2 (B), FASTA

>1E3O_2 5'-D(*TP*CP*CP*TP*CP*AP*TP*GP*CP*AP*T)-3' (chains B)
TCCTCATGCAT

Sequence of entity 3 (C), FASTA

>1E3O_3 OCTAMER-BINDING TRANSCRIPTION FACTOR 1 (chains C)
EEPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNM
SKLKPLLEKWLNDAEANLSSDSSLSSPSALNSPGIEGLSRRRKKRTSIETNIRVALEKSF
MENQKPTSEDITLIAEQLNMEKEVIRVWFSNRRQKEKRIN

Primary citation

Differential Dimer Activities of the Transcription Factor Oct-1 by DNA-Induced Interface Swapping. Remenyi, A., Tomilin, A., Pohl, E. et al. Mol Cell (2001) 8:569. DOI 10.1016/S1097-2765(01)00336-7 · PubMed

Other PDB entries of the same protein (UniProt P14859 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1GT0 2.6 Å, Crystal structure of a POU/HMG/DNA ternary complex
1HF0 2.7 Å, Crystal structure of the DNA-binding domain of Oct-1 bound to DNA as a dimer
1OCT 3.0 Å, Crystal structure of the oct-1 pou domain bound to an octamer site: DNA recognition with…
1CQT 3.2 Å, Crystal structure of a ternary complex containing an oca-B peptide, the oct-1 pou…
1O4X Ternary complex of the DNA binding domains of the OCT1 and SOX2 transcription factors…
1POG Solution structure of the oct-1 pou-homeo domain determined by NMR and restrained…
1POU The solution structure of the oct-1 pou-specific domain reveals a striking similarity to…

Browse structure collections

About this viewer

MolViewer shows 1E3O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.