The solution structure of the oct-1 pou-specific domain reveals a striking similarity to the bacteriophage lambda repressor DNA-binding domain. Determined by solution NMR. Released 15 Oct 1994.
Explore 1POU in 3D Show helices and sheets RCSB PDB PDBe
1POU contains 4 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-23 | 18 | |
| α-helix | 29-37 | 9 | |
| α-helix | 45-51 | 7 | |
| α-helix | 60-73 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| OCT-1 | A | protein | 71 | Homo sapiens | P14859 (AlphaFold model) |
>1POU_1 OCT-1 (chains A) DLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLK PLLEKWLNDAE
The solution structure of the Oct-1 POU-specific domain reveals a striking similarity to the bacteriophage lambda repressor DNA-binding domain. Assa-Munt, N., Mortishire-Smith, R.J., Aurora, R. et al. Cell (1993) 73:193-205. DOI 10.1016/0092-8674(93)90171-L · PubMed
Other PDB entries of the same protein (UniProt P14859 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1POU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.