1OCT: Oct-1 pou domain

Crystal structure of the oct-1 pou domain bound to an octamer site: DNA recognition with tethered DNA-binding modules. Determined by X-ray diffraction at 3.0 Å resolution. Released 31 Aug 1994.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 3
Atoms: 1,670
Mol. weight: 27.19 kDa
Released: 31 Aug 1994

Explore 1OCT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1OCT contains 7 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain C: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	6-22	17
α-helix	27-38	12
α-helix	44-51	8
α-helix	57-74	18
α-helix	110-122	13
α-helix	128-137	10
α-helix	142-159	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA (5'-d(tpgptpaptpgpcpapapaptpapapgp*g)-3')	A	DNA	15
DNA (5'-d(apcpcptptpaptptptpgpcpaptpap*c)-3')	B	DNA	15
Protein (oct-1 pou domain)	C	protein	156	Homo sapiens	P14859 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1OCT_1 DNA (5'-D(*TP*GP*TP*AP*TP*GP*CP*AP*AP*AP*TP*AP*AP*GP*G)-3') (chains A)
TGTATGCAAATAAGG

Sequence of entity 2 (B), FASTA

>1OCT_2 DNA (5'-D(*AP*CP*CP*TP*TP*AP*TP*TP*TP*GP*CP*AP*TP*AP*C)-3') (chains B)
ACCTTATTTGCATAC

Sequence of entity 3 (C), FASTA

>1OCT_3 PROTEIN (OCT-1 POU DOMAIN) (chains C)
DLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLK
PLLEKWLNDAENLSSDSSLSSPSALNSPGIEGLSRRRKKRTSIETNIRVALEKSFLENQK
PTSEEITMIADQLNMEKEVIRVWFCNRRQKEKRINP

Primary citation

Crystal structure of the Oct-1 POU domain bound to an octamer site: DNA recognition with tethered DNA-binding modules. Klemm, J.D., Rould, M.A., Aurora, R. et al. Cell (1994) 77:21-32. DOI 10.1016/0092-8674(94)90231-3 · PubMed

Other PDB entries of the same protein (UniProt P14859 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1E3O 1.9 Å, Crystal structure of Oct-1 POU dimer bound to MORE
1GT0 2.6 Å, Crystal structure of a POU/HMG/DNA ternary complex
1HF0 2.7 Å, Crystal structure of the DNA-binding domain of Oct-1 bound to DNA as a dimer
1CQT 3.2 Å, Crystal structure of a ternary complex containing an oca-B peptide, the oct-1 pou…
1O4X Ternary complex of the DNA binding domains of the OCT1 and SOX2 transcription factors…
1POG Solution structure of the oct-1 pou-homeo domain determined by NMR and restrained…
1POU The solution structure of the oct-1 pou-specific domain reveals a striking similarity to…

Browse structure collections

About this viewer

MolViewer shows 1OCT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.