1EGP: Eglin-C

Name: PDB 1EGP: Proteinase inhibitor eglin C with hydrolysed reactive center
Published: 1995-12-07
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: proteinase inhibitor

Proteinase inhibitor eglin C with hydrolysed reactive center. Determined by X-ray diffraction at 2.0 Å resolution. Released 7 Dec 1995.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Hirudo medicinalis
Chains: 2
Atoms: 629
Mol. weight: 8.12 kDa
Released: 7 Dec 1995

Explore 1EGP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1EGP contains 3 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	9	1	1
α-helix	11-13	3
β-strand	17	1	2
α-helix	18-28	11
β-strand	33-38	6	1
α-helix	41-43	3

Chain B: 0 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	51-56	6	1
β-strand	62	1	2
β-strand	63	1	1
β-strand	68-69	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Eglin-C	A	protein	45	Hirudo medicinalis	P01051 (AlphaFold model)
Eglin-C	B	protein	25	Hirudo medicinalis	P01051 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1EGP_1 EGLIN-C (chains A)
TEFGSELKSFPEVVGKTVDQAREYFTLHYPQYNVYFLPEGSPVTL

Sequence of entity 2 (B), FASTA

>1EGP_2 EGLIN-C (chains B)
DLRYNRVRVFYNPGTNVVNHVPHVG

Primary citation

Structure of the proteinase inhibitor eglin c with hydrolysed reactive centre at 2.0 A resolution. Betzel, C., Dauter, Z., Genov, N. et al. FEBS Lett (1993) 317:185-188. DOI 10.1016/0014-5793(93)81273-3 · PubMed

Other PDB entries of the same protein (UniProt P01051 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1CSE 1.2 Å, The high-resolution X-ray crystal structure of the complex formed between subtilisin…
4B2B 1.36 Å, Structure of the factor Xa-like trypsin variant triple-Ala (TGPA) in complex with eglin C
4B2C 1.43 Å, Structure of the factor Xa-like trypsin variant triple-Ala (TPA) in complex with eglin C
4B1T 1.78 Å, Structure of the factor Xa-like trypsin variant triple-Ala (TA) in complex with eglin C
2SEC 1.8 Å, Structural comparison of two serine proteinase-protein inhibitor complexes.…
4B2A 1.89 Å, Structure of the factor Xa-like trypsin variant triple-Ala (TGA) in complex with eglin C
4H4F 1.9 Å, Crystal structure of human chymotrypsin C (CTRC) bound to inhibitor eglin c from Hirudo…
2TEC 1.98 Å, Molecular dynamics refinement of a thermitase-eglin-C complex at 1.98 Å resolution and…
1ACB 2.0 Å, Crystal and molecular structure of the bovine alpha-chymotrypsin-eglin C complex at 2.0…
1MEE 2.0 Å, The complex between the subtilisin from a mesophilic bacterium and the leech inhibitor…
3TEC 2.0 Å, Calcium binding to thermitase. Crystallographic studies of thermitase at 0, 5 and 100 mm…
1SBN 2.1 Å, Refined crystal structures of subtilisin novo in complex with wild-type and two mutant…

Browse structure collections

About this viewer

MolViewer shows 1EGP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.