1EGW: MEF2A core

Crystal structure of MEF2A core bound to DNA. Determined by X-ray diffraction at 1.5 Å resolution. Released 20 Mar 2000.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Homo sapiens
Chains: 8
Atoms: 5,926
Mol. weight: 57.44 kDa
Released: 20 Mar 2000

Explore 1EGW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1EGW contains 8 α-helices and 8 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	14-38	25
β-strand	42-48	7	1
β-strand	54-58	5	1
α-helix	62-71	10

Chain B: 2 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	14-38	25
β-strand	42-48	7	1
β-strand	54-58	5	1
α-helix	62-72	11

Chain C: 2 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	14-39	26
β-strand	42-48	7	2
β-strand	54-58	5	2
α-helix	62-72	11

Chain D: 2 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	14-38	25
β-strand	42-48	7	2
β-strand	54-58	5	2
α-helix	62-70	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA (5'-d(apapapgpcptpaptptpaptptpapgpcptp*t)-3')	E, H	DNA	17
DNA (5'-d(tpapapgpcptpapaptpapaptpapgpcptp*t)-3')	F, G	DNA	17
Mads box transcription enhancer factor 2, polypeptide a	A, B, C, D	protein	77	Homo sapiens	Q02078 (AlphaFold model)

Sequence of entity 1 (E, H), FASTA

>1EGW_1 DNA (5'-D(*AP*AP*AP*GP*CP*TP*AP*TP*TP*AP*TP*TP*AP*GP*CP*TP*T)-3') (chains E, H)
AAAGCTATTATTAGCTT

Sequence of entity 2 (F, G), FASTA

>1EGW_2 DNA (5'-D(*TP*AP*AP*GP*CP*TP*AP*AP*TP*AP*AP*TP*AP*GP*CP*TP*T)-3') (chains F, G)
TAAGCTAATAATAGCTT

Sequence of entity 3 (A, B, C, D), FASTA

>1EGW_3 MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POLYPEPTIDE A (chains A, B, C, D)
GRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTD
MDKVLLKYTEYNEPHES

Primary citation

Crystal structure of MEF2A core bound to DNA at 1.5 A resolution. Santelli, E., Richmond, T.J. J Mol Biol (2000) 297:437-449. DOI 10.1006/jmbi.2000.3568 · PubMed

Other PDB entries of the same protein (UniProt Q02078 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6WC2 2.1 Å, Crystal Structure of a Ternary MEF2 Chimera/NKX2-5/myocardin enhancer DNA Complex
3P57 2.19 Å, Crystal structure of the p300 TAZ2 domain bound to MEF2 on DNA
1LEW 2.3 Å, Crystal structure of map kinase P38 complexed to the docking site on its nuclear…
6BYY 2.3 Å, MEF2 CHIMERA/DNA Complex
3MU6 2.43 Å, Inhibiting the Binding of Class IIa Histone Deacetylases to Myocyte Enhancer Factor-2 by…
3KOV 2.9 Å, Structure of MEF2A bound to DNA reveals a completely folded MADS-box/MEF2 domain that…
6BZ1 2.97 Å, MEF2 Chimera D83V mutant/DNA complex
7XUZ 3.59 Å, Crystal structure of a HDAC4-MEF2A-DNA ternary complex
1C7U Complex of the DNA binding core domain of the transcription factor MEF2A with a 20mer…

Browse structure collections

About this viewer

MolViewer shows 1EGW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.