3KOV: MEF2A

Structure of MEF2A bound to DNA reveals a completely folded MADS-box/MEF2 domain that recognizes DNA and recruits transcription co-factors. Determined by X-ray diffraction at 2.9 Å resolution. Released 16 Feb 2010.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: Homo sapiens
Chains: 8
Atoms: 4,553
Mol. weight: 58.39 kDa
Released: 16 Feb 2010

Explore 3KOV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3KOV contains 12 α-helices and 12 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, I and J: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	14-38	25
β-strand	42-48	7	1
β-strand	54-58	5	1
α-helix	62-71	10
β-strand	77-80	4	1
α-helix	81-89	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myocyte-specific enhancer factor 2A	A, B, I, J	protein	90	Homo sapiens	Q02078 (AlphaFold model)
DNA (5'-d(apapcptpaptptptpaptpapap*g)-3')	C, K	DNA	13
DNA (5'-d(tpcptptpaptpapapaptpapgp*t)-3')	D, L	DNA	13

Sequence of entity 1 (A, B, I, J), FASTA

>3KOV_1 Myocyte-specific enhancer factor 2A (chains A, B, I, J)
GRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTD
MDKVLLKYTEYNEPHESRTNSDIVEALNKK

Sequence of entity 2 (C, K), FASTA

>3KOV_2 DNA (5'-D(*AP*AP*CP*TP*AP*TP*TP*TP*AP*TP*AP*AP*G)-3') (chains C, K)
AACTATTTATAAG

Sequence of entity 3 (D, L), FASTA

>3KOV_3 DNA (5'-D(*TP*CP*TP*TP*AP*TP*AP*AP*AP*TP*AP*GP*T)-3') (chains D, L)
TCTTATAAATAGT

Primary citation

Structure of the MADS-box/MEF2 Domain of MEF2A Bound to DNA and Its Implication for Myocardin Recruitment. Wu, Y., Dey, R., Han, A. et al. J Mol Biol (2010) 397:520-533. DOI 10.1016/j.jmb.2010.01.067 · PubMed

Other PDB entries of the same protein (UniProt Q02078 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1EGW 1.5 Å, Crystal structure of MEF2A core bound to DNA
6WC2 2.1 Å, Crystal Structure of a Ternary MEF2 Chimera/NKX2-5/myocardin enhancer DNA Complex
3P57 2.19 Å, Crystal structure of the p300 TAZ2 domain bound to MEF2 on DNA
1LEW 2.3 Å, Crystal structure of map kinase P38 complexed to the docking site on its nuclear…
6BYY 2.3 Å, MEF2 CHIMERA/DNA Complex
3MU6 2.43 Å, Inhibiting the Binding of Class IIa Histone Deacetylases to Myocyte Enhancer Factor-2 by…
6BZ1 2.97 Å, MEF2 Chimera D83V mutant/DNA complex
7XUZ 3.59 Å, Crystal structure of a HDAC4-MEF2A-DNA ternary complex
1C7U Complex of the DNA binding core domain of the transcription factor MEF2A with a 20mer…

Browse structure collections

About this viewer

MolViewer shows 3KOV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.