Solution structure of the ena-vasp homology 1 (EVH1) domain of human vasodilator-stimulated phosphoprotein (VASP). Determined by solution NMR. Released 20 Sept 2000.
Explore 1EGX in 3D Show helices and sheets RCSB PDB PDBe
1EGX contains 1 α-helix and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5-10 | 6 | 1 |
| β-strand | 11-12 | 2 | 2 |
| β-strand | 14 | 1 | 3 |
| β-strand | 15-16 | 2 | 2 |
| β-strand | 25 | 1 | 3 |
| β-strand | 34-41 | 8 | 1 |
| β-strand | 46-53 | 8 | 1 |
| β-strand | 60-66 | 7 | 1 |
| β-strand | 79-83 | 5 | 2 |
| β-strand | 88-93 | 6 | 2 |
| α-helix | 96-114 | 19 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Vasodilator-stimulated phosphoprotein | A | protein | 115 | Homo sapiens | P50552 (AlphaFold model) |
>1EGX_1 VASODILATOR-STIMULATED PHOSPHOPROTEIN (chains A) MSETVICSSRATVMLYDDGNKRWLPAGTGPQAFSRVQIYHNPTANSFRVVGRKMQPDQQV VINCAIVRGVKYNQATPNFHQWRDARQVWGLNFGSKEDAAQFAAGMASALEALEG
Dual epitope recognition by the VASP EVH1 domain modulates polyproline ligand specificity and binding affinity. Ball, L.J., Kuhne, R., Hoffmann, B. et al. EMBO J (2000) 19:4903-4914. DOI 10.1093/emboj/19.18.4903 · PubMed
Other PDB entries of the same protein (UniProt P50552 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1EGX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.