1EMU: Axin rgs-homologous domain

Structure of the axin rgs-homologous domain in complex with a samp repeat from apc. Determined by X-ray diffraction at 1.9 Å resolution. Released 5 Jul 2000.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,337
Mol. weight: 17.76 kDa
Released: 5 Jul 2000

Explore 1EMU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1EMU contains 14 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	118-121	4
α-helix	126-129	4
α-helix	133-145	13
α-helix	150-162	13
α-helix	168-170	3
α-helix	171-181	11
α-helix	182-186	5
α-helix	192-195	4
α-helix	199-211	13
α-helix	220-229	10
α-helix	230-234	5
α-helix	235-239	5
α-helix	242-247	6

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	2037-2046	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Axin	A	protein	132	Homo sapiens	O15169 (AlphaFold model)
Adenomatous polyposis coli protein	B	protein	16		P25054

Sequence of entity 1 (A), FASTA

>1EMU_1 AXIN (chains A)
PPYLKWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFACTGFRKLEPCDSNEEKRLK
LARAIYRKYILDNNGIVSRQTKPATKSFIKGCIMKQLIDPAMFDQAQTEIQATMEENTYP
SFLKSDIYLEYT

Sequence of entity 2 (B), FASTA

>1EMU_2 ADENOMATOUS POLYPOSIS COLI PROTEIN (chains B)
SEDDLLQECISSAMPK

Primary citation

Structural basis of the Axin-adenomatous polyposis coli interaction. Spink, K.E., Polakis, P., Weis, W.I. EMBO J (2000) 19:2270-2279. DOI 10.1093/emboj/19.10.2270 · PubMed

Other PDB entries of the same protein (UniProt O15169 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1DK8 1.57 Å, Crystal structure of the rgs-homologous domain of axin
7SXJ 1.85 Å, BIO-2895 (BRD0705) bound GSK3beta-axin complex
7SXF 1.94 Å, BIO-2895 (BRD0705) bound GSK3alpha-axin complex
8RU3 2.0 Å, Crystal structure of beta-catenin in complex with alpha-helical peptide inhibitor
7SXH 2.09 Å, BIO-8546 bound GSK3beta-axin complex
4NM3 2.1 Å, Crystal structure of GSK-3/Axin complex bound to phosphorylated N-terminal…
5WZZ 2.1 Å, The SIAH E3 ubiquitin ligases promote Wnt/ beta-catenin signaling through mediating…
8RU4 2.13 Å, Crystal structure of Human Catenin Beta-1 in complex with stitched peptide inhibitor
4NM5 2.3 Å, Crystal structure of GSK-3/Axin complex bound to phosphorylated Wnt receptor LRP6 c-motif
4NM7 2.3 Å, Crystal structure of GSK-3/Axin complex bound to phosphorylated Wnt receptor LRP6 e-motif
8VME 2.3 Å, Crystal structure of the GSK-3/Axin complex bound to a phosphorylated beta-catenin T41A…
1O9U 2.4 Å, Glycogen synthase kinase 3 beta complexed with axin peptide

Browse structure collections

About this viewer

MolViewer shows 1EMU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.