1ENW: Elongation factor tfiis domain II

Elongation factor tfiis domain II. Determined by solution NMR. Released 12 Apr 2000.

Method: Solution NMR
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 893
Mol. weight: 12.73 kDa
Released: 12 Apr 2000

Explore 1ENW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1ENW contains 7 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	23-37	15
α-helix	45-52	8
α-helix	66-70	5
α-helix	71-75	5
α-helix	76-80	5
α-helix	91-94	4
α-helix	102-105	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription elongation factor S-II	A	protein	114	Saccharomyces cerevisiae	P07273 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1ENW_1 TRANSCRIPTION ELONGATION FACTOR S-II (chains A)
GSHMPRNSKNDGVDTAIYHHKLRDQVLKALYDVLAKESEHPPQSILHTAKAIESEMNKVN
NCDTNEAAYKARYRIIYSNVISKNNPDLKHKIANGDITPEFLATCDAKDLAPAP

Primary citation

Elongation factor TFIIS contains three structural domains: solution structure of domain II. Morin, P.E., Awrey, D.E., Edwards, A.M. et al. Proc Natl Acad Sci U S A (1996) 93:10604-10608. DOI 10.1073/pnas.93.20.10604 · PubMed

Other PDB entries of the same protein (UniProt P07273 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7FAW 2.44 Å, Structure of LW domain from Yeast
3PO3 3.3 Å, Arrested RNA Polymerase II reactivation intermediate
7UI9 3.3 Å, Core Mediator-PICearly (Copy A)
7UIO 3.3 Å, Mediator-PIC Early (Composite Model)
8UMI 3.7 Å, consensus map of PICdeltaTFIIK form1
8UOT 3.7 Å, Composite map of PICdeltaTFIIK form1
1PQV 3.8 Å, RNA polymerase II-TFIIS complex
1Y1V 3.8 Å, Refined RNA Polymerase II-TFIIS complex
3GTM 3.8 Å, Co-complex of Backtracked RNA polymerase II with TFIIS
8UOQ 3.8 Å, Composite map of PIC_delta_TFIIK form2
1Y1Y 4.0 Å, RNA Polymerase II-TFIIS-DNA/RNA complex
8UMH 4.1 Å, Consensus map of PICdeltaTFIIK form2

Browse structure collections

About this viewer

MolViewer shows 1ENW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.