7FAW: LW domain from Yeast

Structure of LW domain from Yeast. Determined by X-ray diffraction at 2.44 Å resolution. Released 13 Jul 2022.

Method: X-ray diffraction
Resolution: 2.44 Å
Organism: Saccharomyces cerevisiae S288C
Chains: 3
Atoms: 2,015
Mol. weight: 29.4 kDa
Released: 13 Jul 2022

Explore 7FAW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7FAW contains 16 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	3-15	13
α-helix	20-33	14
α-helix	38-44	7
α-helix	46-51	6
α-helix	52-55	4
α-helix	59-82	24

Chains B and C: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	3-15	13
α-helix	20-33	14
α-helix	38-44	7
α-helix	46-51	6
α-helix	59-82	24

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription elongation factor S-II	A, B, C	protein	85	Saccharomyces cerevisiae S288C	P07273 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>7FAW_1 Transcription elongation factor S-II (chains A, B, C)
MDSKEVLVHVKNLEKNKSNDAAVLEILHVLDKEFVPTEKLLRETKVGVEVNKFKKSTNVE
ISKLVKKMISSWKAQLNLENLYFQG

Primary citation

Structural basis for evolutionarily conserved interactions between TFIIS and Paf1C. Gao, J., Jishage, M., Wang, Y. et al. Int J Biol Macromol (2023) 253:126764-126764. DOI 10.1016/j.ijbiomac.2023.126764 · PubMed

Other PDB entries of the same protein (UniProt P07273 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3PO3 3.3 Å, Arrested RNA Polymerase II reactivation intermediate
7UI9 3.3 Å, Core Mediator-PICearly (Copy A)
7UIO 3.3 Å, Mediator-PIC Early (Composite Model)
8UMI 3.7 Å, consensus map of PICdeltaTFIIK form1
8UOT 3.7 Å, Composite map of PICdeltaTFIIK form1
1PQV 3.8 Å, RNA polymerase II-TFIIS complex
1Y1V 3.8 Å, Refined RNA Polymerase II-TFIIS complex
3GTM 3.8 Å, Co-complex of Backtracked RNA polymerase II with TFIIS
8UOQ 3.8 Å, Composite map of PIC_delta_TFIIK form2
1Y1Y 4.0 Å, RNA Polymerase II-TFIIS-DNA/RNA complex
8UMH 4.1 Å, Consensus map of PICdeltaTFIIK form2
7UIF 4.6 Å, Mediator-PIC Early (Core B)

Browse structure collections

About this viewer

MolViewer shows 7FAW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.