1EO0: Transcription elongation factor S-II

Name: PDB 1EO0: Conserved domain common to transcription factors tfiis, elongin a, CRSP70
Published: 2000-05-03
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Conserved domain common to transcription factors tfiis, elongin a, CRSP70. Determined by solution NMR. Released 3 May 2000.

Method: Solution NMR
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 618
Mol. weight: 8.82 kDa
Released: 3 May 2000

Explore 1EO0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1EO0 contains 4 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	3-16	14
α-helix	21-30	10
α-helix	40-52	13
α-helix	61-76	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription elongation factor S-II	A	protein	77	Saccharomyces cerevisiae	P07273 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1EO0_1 TRANSCRIPTION ELONGATION FACTOR S-II (chains A)
MDSKEVLVHVKNLEKNKSNDAAVLEILHVLDKEFVPTEKLLRETKVGVEVNKFKKSTNVE
ISKLVKKMISSWKDAIN

Primary citation

Structure of a conserved domain common to the transcription factors TFIIS, elongin A, and CRSP70. Booth, V., Koth, C., Edwards, A.M. et al. J Biol Chem (2000) 275:31266-31268. DOI 10.1074/jbc.M002595200 · PubMed

Other PDB entries of the same protein (UniProt P07273 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7FAW 2.44 Å, Structure of LW domain from Yeast
3PO3 3.3 Å, Arrested RNA Polymerase II reactivation intermediate
7UI9 3.3 Å, Core Mediator-PICearly (Copy A)
7UIO 3.3 Å, Mediator-PIC Early (Composite Model)
8UMI 3.7 Å, consensus map of PICdeltaTFIIK form1
8UOT 3.7 Å, Composite map of PICdeltaTFIIK form1
1PQV 3.8 Å, RNA polymerase II-TFIIS complex
1Y1V 3.8 Å, Refined RNA Polymerase II-TFIIS complex
3GTM 3.8 Å, Co-complex of Backtracked RNA polymerase II with TFIIS
8UOQ 3.8 Å, Composite map of PIC_delta_TFIIK form2
1Y1Y 4.0 Å, RNA Polymerase II-TFIIS-DNA/RNA complex
8UMH 4.1 Å, Consensus map of PICdeltaTFIIK form2

Browse structure collections

About this viewer

MolViewer shows 1EO0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.